(data stored in ACNUC13479 zone)

EMBL: AK015469

ID   AK015469; SV 1; linear; mRNA; HTC; MUS; 1903 BP.
XX
AC   AK015469;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4930455J05 product:SIGNAL RECOGNITION PARTICLE RECEPTOR BETA SUBUNIT
DE   (SR-BETA) homolog [Mus musculus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1903
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 25907bfb48157d398e8ad5d291376cbd.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4930455J05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1903
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4930455J05"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        72..881
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SIGNAL RECOGNITION PARTICLE RECEPTOR BETA SUBUNIT
FT                   (SR-BETA) homolog [Mus musculus] (SWISSPROT|P47758,
FT                   evidence: FASTY, 100%ID, 100%length, match=807)"
FT                   /note="putative"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAB29860.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
XX
SQ   Sequence 1903 BP; 419 A; 522 C; 511 G; 451 T; 0 other;
     ggcgccccac cacggcgtgg agcctagagc cacgtaactt tggcggcccg ggaagactac        60
     acacctcttt catggcttcg gcgaacacac ggcgagttgg cgatggcgcc ggtggcgcct       120
     tccagcctta cctcgactcc ttacgacagg agctgcagca gagggatccg acgctgctct       180
     ccgtggcggt ggctctcctg gcggtgctgc tgacgctggt gttctggaag ttcatctgga       240
     gccgaaagag cagtcagaga gctgttctct tcgttggtct ctgtgactct gggaaaacgt       300
     tgctgtttgt caggttgcta actggccagt acagagacac acagacttcc attaccgata       360
     gttctgccat atacaaagtc aacaataaca ggggtaacag cctgactctg atcgacctcc       420
     ccgggcatga gagcttgagg tttcagctct tagatcgctt taagtcttca gctagggctg       480
     tggtgtttgt ggtggacagt gcggcgttcc agcgggaggt gaaagatgtg gccgaatttc       540
     tgtaccaggt cctcatcgac agcatggctc tgaagaactc accgtcctta ttaatagcct       600
     gcaataagca agatatcgca atggcaaaat cagcgaagtt gatccagcag cagcttgaga       660
     aggagctcaa caccttacga gtcacccggt ccgcggctcc cagcacactg gacagttcca       720
     gcaccgcacc tgctcagttg gggaagaaag gcaaagaatt tgaattttcc cagttgccac       780
     tcaaagtgga gttcctggag tgtagtgcca agggtggacg aggggacact ggctctgctg       840
     acatccagga cttggagaag tggctggcca agattgcctg aggagcatcg ctggccacaa       900
     gcgttggtca tgtgagactg accctgcagt ttgagaaagg gcggtggtgg tgtggactga       960
     taaagagggg gcatgtcgtt gaagcatttc ttgagttctt gaaacaattg taccaccccc      1020
     accccacccc cgtcagctcc tttctcagct agtcctttct taattcccat attctttctc      1080
     cctttgctag gtgttaggtg tagcatcatg ttagtgtgag acataacaga gagggcatcg      1140
     ctttgagagt agggtcgcat ctgagaagtc cttgtctcct gcctctgtgt tggtcccttt      1200
     tcctgggacc agatctgcct gcttgtggaa taagtgaact tgcagttgcc cctggtgtag      1260
     gcataataca gtgtcagttc ttagtggagt ctggggtgtg aaggtctaca gtgaagacag      1320
     cttcaaagcc acaggcacag ctgacagtgt gtccttcacg ggctcagtga ccatcccaca      1380
     ccaccctagc tgacagtgtg tccttcacgg gctcggtgac catcccacac caccctagct      1440
     gacagtgtgt ccttcacggg ctcggtgacc atcccacacc accctagctg acagtgtgtc      1500
     cttcacaggc tcggtgacca tcccacacca ccctagctga cagtgtgtcc ttcatgggct      1560
     cggtgaccat cccacaccac cctagctgac agtgtgtcct tcacgggctc ggtgaccatc      1620
     cccacaccac cctaggttca aaagctgccg caaccccgaa gagtcaccct cacaaggtgg      1680
     ctttaggagc caaatcccca gacactccta ggttagtgtt ttagaggctc caatggggag      1740
     agcagggaga cagcacactg ttgcctcggg cgtgcgtgag cccaggctgt cccctgtgct      1800
     acttgatcag ctcctgttgt gtcaccccag ctagagtgct atggaacaat acaaactgaa      1860
     gatgtccact gtgcatttta aatacatatt tattcatgat gcc                        1903
//

If you have problems or comments...

PBIL Back to PBIL home page