(data stored in ACNUC8465 zone)

EMBL: AK020716

ID   AK020716; SV 1; linear; mRNA; HTC; MUS; 1153 BP.
XX
AC   AK020716;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230106F01 product:MITOGEN ACTIVATED PROTEIN KINASE KINASE 5
DE   homolog [Mus musculus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1153
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 24c2332b048be855739995b3db6f539f.
DR   Ensembl-Gn; ENSMUSG00000058444; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034928; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034908; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034901; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034611; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035420; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033932; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034582; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034683; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034824; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034726; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035442; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033636; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034045; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034920; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0092762; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0092839; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0092788; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0092762; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0092341; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0093287; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0092951; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0092270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0092477; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0092323; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0092493; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0092323; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0093603; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0092373; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0091361; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230106F01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1153
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230106F01"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        624..980
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="MITOGEN ACTIVATED PROTEIN KINASE KINASE 5 homolog
FT                   [Mus musculus] (SPTR|Q9D222, evidence: FASTY, 100%ID,
FT                   100%length, match=354)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9WVS7"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="MGI:MGI:1346345"
FT                   /db_xref="PDB:1WI0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVS7"
FT                   /protein_id="BAB32187.1"
FT                   /translation="MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL
FT                   DVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQI
FT                   FPRGYRRGSRLREY"
FT   regulatory      1136..1141
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1153
FT                   /note="putative"
XX
SQ   Sequence 1153 BP; 236 A; 340 C; 287 G; 290 T; 0 other;
     gggccgcctt cctcctcctc tcgccgccac ctccgctgcc gggacgcggg cctcagtcgg        60
     acgatcctgc acgcgccgcg ccctccggtt ccggctgcgg tccgggaccc gccccttgac       120
     cccgcggccc tgggcccccc tgcctggttg gagggcaggc gccaccggtg cacctccgaa       180
     acagccccga cccagcccgc ggcgcccggc caccgtcccc ttgcccaccg agacactcag       240
     gacggcagga ccctggccac tgtacctgcc ttaaaccagg ccgttgctcc gctgtctcct       300
     cttactcaca aggactacag aatgcttgtg ggttctgttt tgtccacttt tgtaactcca       360
     ggaccttccg ctctctacta attcctcttg gccggtcccc caacagtgca tcctctccta       420
     gggacactcc acacgacctg ggcctggttt tgggcctgca agctccctcc tgatcgctcc       480
     tcttcacttc tccccatctt cttgctccct atttatcgcc tgccttctgt ctatcgttcc       540
     ccttgtcact tcttggggct cctcctaagt agggggcagg tcggtacccc tcgccccagg       600
     atgtgagaac cctttaacct gtaatgctgt ggttggccct tggccccttc tgtgccatgg       660
     agaaccaggt gctggtgatt cggatcaaga ttccaaatag tggcgcggtg gactggaccg       720
     tgcactccgg gccgcagtta ctcttcaggg atgttctgga tgtgataggc caggttctgc       780
     ctgaagcgac gacgacagcg tttgaatatg aagatgaaga tggtgatagg attacagtaa       840
     gaagcgatga agagatgaag gcaatgctgt cctactatta ttccacagta atggaacagc       900
     aagtaaatgg ccagctaata gagccgctgc agatatttcc aagaggttac cgcagaggca       960
     gtcgtctgag agaatactga ggcttccagg gctgggcgtc agaagaaggc agccgttgtt      1020
     ttgttaatct gtattttaag gaaagaagat ttggaatctt aatatattaa gtatcctata      1080
     cgcttaaaat ataaaaacat ttattcatgt ttatgtattt ttggaatatt aatgtaataa      1140
     attcatttaa aat                                                         1153
//

If you have problems or comments...

PBIL Back to PBIL home page