(data stored in ACNUC24361 zone)

EMBL: AK027060

ID   AK027060; SV 1; linear; mRNA; STD; HUM; 2081 BP.
XX
AC   AK027060;
XX
DT   29-SEP-2000 (Rel. 65, Created)
DT   12-SEP-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Homo sapiens cDNA: FLJ23407 fis, clone HEP19601.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Sugano S., Suzuki Y., Ota T., Obayashi M., Nishi T., Isogai T.,
RA   Shibahara T., Tanaka T., Nakamura Y.;
RT   ;
RL   Submitted (29-AUG-2000) to the INSDC.
RL   Sumio Sugano, Institute of Medical Science, University of Tokyo, Laboratory
RL   of Genome Structure Analysis, Human Genome Center; Shirokane-dai, 4-6-1,
RL   Minato-ku, Tokyo 108-8639, Japan (E-mail:flcdna@ims.u-tokyo.ac.jp,
RL   Tel:81-3-5449-5286, Fax:81-3-5449-5416)
XX
RN   [2]
RP   1-2081
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Ota T., Suzuki Y., Obayashi M., Nishi T., Shibahara T.,
RA   Tanaka T., Nakamura Y., Isogai T., Sugano S.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 7d1b647a4b3592090ec1065aa8799706.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing: Departent of
CC   Virology and Human Genome Center, Institute of Medical Science,
CC   University of Tokyo (partly supported by Science and Technology
CC   Agency).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2081
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="HEP"
FT                   /clone="HEP19601"
FT                   /cell_line="HepG2"
FT                   /cell_type="hepatoma"
FT                   /note="cloning vector pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        7..636
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9H5I3"
FT                   /db_xref="H-InvDB:HIT000010334.17"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q9H5I3"
FT                   /protein_id="BAB15643.1"
FT                   /translation="MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCN
FT                   ECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECG
FT                   KAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF
FT                   IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP"
XX
SQ   Sequence 2081 BP; 662 A; 386 C; 425 G; 608 T; 0 other;
     aaagaaatgg aacatttggg ggatagcaga ctccaaagag atgtatcttt ggattctaag        60
     tacagagaaa cttgtaaacg agacagcaag gcagaaaagc agcaggcaca ttccactgga       120
     gagagacgcc acaggtgcaa tgaatgtggg aaaagcttca ctaagagttc agtactcatt       180
     gagcaccaga gaatccacac tggggagaag ccatatgaat gtgaagaatg tgggaaggcc       240
     ttcagccgga ggtcaagcct gaatgaacat cggcggagcc acactggaga gaaaccctat       300
     caatgtaagg agtgtgggaa agccttcagt gccagcaatg gcctcactcg acacagaaga       360
     atccacacag gggaaaaacc atatgaatgc aaagtgtgtg ggaaggcttt cctcctcagc       420
     tcatgccttg ttcagcatca gaggatacac actggagaga agcgctatca gtgtcgtgag       480
     tgtggcaaag ccttcattca gaatgcaggg cttttccagc atctccgagt ccacactggt       540
     gagaaaccct atcagtgcag tcagtgcagt aaactcttta gtaagcggac acttcttaag       600
     aaacatcaga aaatccacac tggagagaga ccataagggt gatgagtttg ggaaagcctt       660
     cagtcatcat tgcaacctta ttaggcattt tagaatccat actgttccag cagaactgga       720
     ctaattctgt ggaccctcag acccctaaat ggggccgtct tggaaagtaa gattttcaag       780
     tggcttattc tgttcttata aaatttattt tgtattgcat tgaaccactt gtctacaaac       840
     caggtgttgg tgtctcctgt gtggatgact gtgattgtag ggggttactg ggtggccttc       900
     ttattcccta gcctttggtc catttcttat gatttccttt aaaggcacca aatcttatct       960
     ggaaataaat tgttatggag gggctgtttt tgagcaatac tgcatattga acaattctaa      1020
     aagaccagta tctatgtata cttttaaaaa aaagatttgc taagatcaaa ggatattcag      1080
     aggtgcatct ttttctgtaa gagtgacatt ttaaacaaat gtaaggtttt ggggaataag      1140
     aatcgtccac attcccacag gaaatcattg ctatggtctc ccctaggact gtgatagata      1200
     gcttctataa ttatgcagca ttatccatag tatgaaacct gtagttttaa tggtttagaa      1260
     atctatgtct catttcatat ctaactcatg tttttgatac gaatcaatat atatgttgat      1320
     atcatgagtt aatatgagtt tgacatgaat catcaacata gtatatacat atcaacataa      1380
     ctatgttgat gattcatatc aaattctcaa tgcaggtcat tactgtaagt tttccatttt      1440
     tgttacaaat aataagtaag atgatacttt aaaatctctg ttcttcacaa ggtacctctt      1500
     taattcatag ccttttatgt cagcattatt cttcttttgg gggttggtca gcaactttga      1560
     gtgccattgc aagcagcatc atttaagtag ttttataaag aaaagaagtc tgatatcttg      1620
     ggcagcttgc tgcttactgg ggagaccagc atgcttagac acttattgcc agggttaaac      1680
     atatgctctg gcaccaagtt caaatctttc ctccccattt gtgagctgtg ggactttagg      1740
     caagttatct aaatgctgct atgctatagt ctccccacct gtaaaacaga ggacgatacc      1800
     aataccttcc tcatagggta cataagatta aataaataca aacttgtact taaaatgtag      1860
     ctctcaataa atgtgcatta tgatttacat acgaaataat agcatttaac aaatgtaggt      1920
     agaattttaa gtatcatgtt aaaattagga tacgaaatgc ctctgctgac attcttgtta      1980
     ctcttttctc cacagtcaaa acctgaatca gaatatttca aaagagagga aataaaagtt      2040
     cagcttaaaa ctgttctgcc ctgaaaaaaa aaaaaaaaaa a                          2081
//

If you have problems or comments...

PBIL Back to PBIL home page