(data stored in ACNUC21429 zone)

EMBL: AK027556

ID   AK027556; SV 1; linear; mRNA; STD; HUM; 2392 BP.
XX
AC   AK027556;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens cDNA FLJ14650 fis, clone NT2RP2002185, highly similar to
DE   Ubiquilin-1.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2392
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (10-MAY-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Takahashi-Fujii A., Hara H., Tanase T.,
RA   Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Nabekura T., Ishii S., Kawai Y., Saito K., Yamamoto J., Wakamatsu A.,
RA   Nakamura Y., Nagahari K., Masuho Y., Oshima A.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; ade997f689b27f8e402466734ca14ff2.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology; cDNA library construction,
CC   5'- & 3'-end one pass sequencing and clone selection: Helix
CC   Research Institute (supported by Japan Key Technology Center etc.)
CC   and Department of Virology, Institute of Medical Science,
CC   University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2392
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP2"
FT                   /clone="NT2RP2002185"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        274..2043
FT                   /codon_start=1
FT                   /note="highly similar to Ubiquilin-1"
FT                   /db_xref="H-InvDB:HIT000010828.19"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B3KNI2"
FT                   /protein_id="BAG51344.1"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPK
FT                   EKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPLVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPR
FT                   AMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGT
FT                   TEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDI
FT                   NAAIERLLGSQPS"
XX
SQ   Sequence 2392 BP; 651 A; 590 C; 555 G; 596 T; 0 other;
     gaggaagcgg tggctgctgc ggatgtcggt gtgagcgagc ggcgcctgaa cacacggcgg        60
     ctgccgagcg cctgacccgg gcctgcgcca gagcctgcac cgagctccgg ggccccacac       120
     ccgctacggt ggccctgcgc ccgttgctac tgaggcggcg tgctctgcat tcttcgctgt       180
     ccaggcctgc cggctctggt gtctgctggc tcctccttgc tcgcctgctc cctcctgctt       240
     gcctgagtca tcgccgccgc cgccgccaca gccatggccg agagtggtga aagcggcggt       300
     cctccgggct cccaggatag cgccgccgga gccgaaggtg ctggcgcccc cgcggccgct       360
     gcctccgcgg agcccaaaat catgaaagtc accgtgaaga ccccgaagga aaaggaggaa       420
     ttcgccgtgc ccgagaatag ctccgtccag cagtttaagg aagaaatctc taaacgtttt       480
     aaatcacata ctgaccaact tgtgttgata tttgctggaa aaattttgaa agatcaagat       540
     accttgagtc agcatggaat tcatgatgga cttactgttc accttgtcat taaaacacaa       600
     aacaggcctc aggatcattc agctcagcaa acaaatacag ctggaagcaa tgttactaca       660
     tcatcaactc ctaatagtaa ctctacatct ggttctgcta ctagcaaccc ttttggttta       720
     ggtggccttg ggggacttgc aggtctgagt agcttgggtt tgaatactac caacttctct       780
     gaactacaga gtcagatgca gcgacaactt ttgtctaacc ctgaaatgat ggtccagatc       840
     atggaaaatc cccttgttca gagcatgctc tcaaatcctg acctgatgag acagttaatt       900
     atggccaatc cacaaatgca gcagttgata cagagaaatc cagaaattag tcatatgttg       960
     aataatccag atataatgag acaaacgttg gaacttgcca ggaatccagc aatgatgcag      1020
     gagatgatga ggaaccagga ccgagctttg agcaacctag aaagcatccc agggggatat      1080
     aatgctttaa ggcgcatgta cacagatatt caggaaccaa tgctgagtgc tgcacaagag      1140
     cagtttggtg gtaatccatt tgcttccttg gtgagcaata catcctctgg tgaaggtagt      1200
     caaccttccc gtacagaaaa tagagatcca ctacccaatc catgggctcc acagacttcc      1260
     cagagttcat cagcttccag cggcactgcc agcactgtgg gtggcactac tggtagtact      1320
     gccagtggca cttctgggca gagtactact gcgccaaatt tggtgcctgg agtaggagct      1380
     agtatgttca acacaccagg aatgcagagc ttgttgcaac aaataactga aaacccacaa      1440
     cttatgcaaa acatgttgtc tgccccctac atgagaagca tgatgcagtc actaagccag      1500
     aatcctgacc ttgctgcaca gatgatgctg aataatcccc tatttgctgg aaatcctcag      1560
     cttcaagaac aaatgagaca acagctccca actttcctcc aacaaatgca gaatcctgat      1620
     acactatcag caatgtcaaa ccctagagca atgcaggcct tgttacagat tcagcagggt      1680
     ttacagacat tagcaacgga agccccgggc ctcatcccag ggtttactcc tggcttgggg      1740
     gcattaggaa gcactggagg ctcttcggga actaatggat ctaacgccac acctagtgaa      1800
     aacacaagtc ccacagcagg aaccactgaa cctggccatc agcagtttat tcagcagatg      1860
     ctgcaggctc ttgctggagt aaatcctcag ctacagaatc cagaagtcag atttcagcaa      1920
     caactggaac aactcagtgc aatgggattt ttgaaccgtg aagcaaactt gcaagctcta      1980
     atagcaacag gaggtgatat caatgcagct attgaaaggt tactgggctc ccagccatca      2040
     tagcagcatt tctgtatctt gaaaaaatgt aatttatttt tgataacggc tcttaaactt      2100
     taaaatacct gctttatttc attttgactc ttggaattct gtgctgttat aaacaaaccc      2160
     aatatgatgc attttaaggt ggagtacagt aagatgtgtg ggtttttctg ttttttcttt      2220
     tctggaacag tgggaattaa ggctactgca tgcatcactt ctgcatttat tgtaattttt      2280
     taaaaacatc accttttata gttgggtgac cagattttgt cctgcatctg tccagtttat      2340
     ttgcttttta aacattagcc tatggtagta atttatgtag aataaaagca tt              2392
//

If you have problems or comments...

PBIL Back to PBIL home page