(data stored in ACNUC21429 zone)

EMBL: AK027576

ID   AK027576; SV 1; linear; mRNA; STD; HUM; 2944 BP.
XX
AC   AK027576;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens cDNA FLJ14670 fis, clone NT2RP2003272, highly similar to
DE   Ubiquilin-1.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2944
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (10-MAY-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Takahashi-Fujii A., Hara H., Tanase T.,
RA   Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Nabekura T., Ishii S., Kawai Y., Saito K., Yamamoto J., Wakamatsu A.,
RA   Nakamura Y., Nagahari K., Masuho Y., Oshima A.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 77ee54c75e09fb7086615827151b2ef2.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology; cDNA library construction,
CC   5'- & 3'-end one pass sequencing and clone selection: Helix
CC   Research Institute (supported by Japan Key Technology Center etc.)
CC   and Department of Virology, Institute of Medical Science,
CC   University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2944
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP2"
FT                   /clone="NT2RP2003272"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        265..2034
FT                   /codon_start=1
FT                   /note="highly similar to Ubiquilin-1"
FT                   /db_xref="H-InvDB:HIT000010848.19"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B3KNI8"
FT                   /protein_id="BAG51350.1"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPK
FT                   EKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMRNPDTLSAMSNPR
FT                   AMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGT
FT                   TEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDI
FT                   NAAIERLLGSQPS"
XX
SQ   Sequence 2944 BP; 834 A; 682 C; 647 G; 781 T; 0 other;
     gtggctgctg cggatgtcgg tgtgagcgag cggcgcctga acacacggcg gctgccgagc        60
     gcctgacccg ggcctgcgcc agagcctgca ccgagctccg gggccccaca cccgctacgg       120
     tggccctgcg cccgttgcta ctgaggcggc gtgctctgca ttcttcgctg tccaggcctg       180
     ccggctctgg tgtctgctgg ctcctccttg ctcgcctgct ccctcctgct tgcctgagtc       240
     accgccgccg ccgccgccac agccatggcc gagagtggtg aaagcggcgg tcctccgggc       300
     tcccaggata gcgccgccgg agccgaaggt gctggcgccc ccgcggccgc tgcctccgcg       360
     gagcccaaaa tcatgaaagt caccgtgaag accccgaagg aaaaggagga attcgccgtg       420
     cccgagaata gctccgtcca gcagtttaag gaagaaatct ctaaacgttt taaatcacat       480
     actgaccaac ttgtgttgat atttgctgga aaaattttga aagatcaaga taccttgagt       540
     cagcatggaa ttcatgatgg acttactgtt caccttgtca ttaaaacaca aaacaggcct       600
     caggatcatt cagctcagca aacaaataca gctggaagca atgttactac atcatcaact       660
     cctaatagta actctacatc tggttctgct actagcaacc cttttggttt aggtggcctt       720
     gggggacttg caggtctgag tagcttgggt ttgaatacta ccaacttctc tgaactacag       780
     agtcagatgc agcgacaact tttgtctaac cctgaaatga tggtccagat catggaaaat       840
     ccctttgttc agagcatgct ctcaaatcct gacctgatga gacagttaat tatggccaat       900
     ccacaaatgc agcagttgat acagagaaat ccagaaatta gtcatatgtt gaataatcca       960
     gatataatga gacaaacgtt ggaacttgcc aggaatccag caatgatgca ggagatgatg      1020
     aggaaccagg accgagcttt gagcaaccta gaaagcatcc cagggggata taatgcttta      1080
     aggcgcatgt acacagatat tcaggaacca atgctgagtg ctgcacaaga gcagtttggt      1140
     ggtaatccat ttgcttcctt ggtgagcaat acatcctctg gtgaaggtag tcaaccttcc      1200
     cgtacagaaa atagagatcc actacccaat ccatgggctc cacagacttc ccagagttca      1260
     tcagcttcca gcggcactgc cagcactgtg ggtggcacta ctggtagtac tgccagtggc      1320
     acttctgggc agagtactac tgcgccaaat ttggtgcctg gagtaggagc tagtatgttc      1380
     aacacaccag gaatgcagag cttgttgcaa caaataactg aaaacccaca actgatgcaa      1440
     aacatgttgt ctgcccccta catgagaagc atgatgcagt cactaagcca gaatcctgac      1500
     cttgctgcac agatgatgct gaataatccc ctatttgctg gaaatcctca gcttcaagaa      1560
     caaatgagac aacagctccc aactttcctc caacaaatgc ggaatcctga tacactatca      1620
     gcaatgtcaa accctagagc aatgcaggcc ttgttacaga ttcagcaggg tttacagaca      1680
     ttagcaacgg aagccccggg ccttatccca gggtttactc ctggcttggg ggcattagga      1740
     agcactggag gctcttcggg aactaatgga tctaacgcca cacctagtga aaacacaagt      1800
     cccacagcag gaaccactga acctggacat cagcagttta ttcagcagat gctgcaggct      1860
     cttgctggag taaatcctca gctacagaat ccagaagtca gatttcagca acaactggaa      1920
     caactcagtg caatgggatt tttgaaccgt gaagcaaact tgcaagctct aatagcaaca      1980
     ggaggtgata tcaatgcagc tattgaaagg ttactgggct cccagccatc atagcagcat      2040
     ttctgtatct tgaaaaaatg taatttattt ttgataacgg ctcttaaact ttaaaatacc      2100
     tgctttattt cattttgact cttggaattc tgtgctgtta taaacaaacc caatatgatg      2160
     cattttaagg tggagtacag taagatgtgt gggtttttct gtatttttct tttctggaac      2220
     agtgggaatt aaggctactg catgcatcac ttctgcattt attgtaattt tttaaaaaca      2280
     tcacctttta tagttgggtg accagatttt gtcctgcatc tgtccagttt atttgctttt      2340
     taaacattag cctatggtag taatttatgt agaataaaag cattaaaaag aagcaaatca      2400
     tttgcactct ataatttgtg gtacagtatt gcttattgtg actttggcat gcatttttgc      2460
     aaacaatgct gtaagattta tactactgat aattttgttt tatttgtata caatatagag      2520
     tatgcacatt tgggactgca tttctggaaa catactgcaa taggctctct gagcaaaaca      2580
     cctgtaacta aaaaagtgaa gataagaaaa tactcttaaa gctgagtatt tcctaattgt      2640
     atagaatctt acagcatctt tgacaaacat ctcccagcaa aagtgccggt tagtcaggtt      2700
     tgttgaaaat acagtagaaa agctgattct ggttatctct ttaaggacaa ttaattgtac      2760
     agacacataa tgtaacattg tctcaacatt cattcacaga ttgactgtaa attaccttaa      2820
     tctttgtgca gactgaagga acactgtagt ataccccaaa gtgcatttgc ctaggacttc      2880
     tcagcttctc ccataggtag tttaacaggc attaaaattt gtaattgaaa tgttgctttc      2940
     actg                                                                   2944
//

If you have problems or comments...

PBIL Back to PBIL home page