(data stored in ACNUC24361 zone)

EMBL: AK027714

ID   AK027714; SV 1; linear; mRNA; STD; HUM; 3172 BP.
XX
AC   AK027714;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens cDNA FLJ14808 fis, clone NT2RP4001790, highly similar to Zinc
DE   finger protein 95 homolog.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3172
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (10-MAY-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Ishibashi T., Fujimori K., Tanai H.,
RA   Kimata M., Watanabe M., Hiraoka S., Ishii S., Kawai Y., Saito K.,
RA   Yamamoto J., Wakamatsu A., Nakamura Y., Nagahari K., Masuho Y.,
RA   Kanehori K.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; bd5d832ea97838193393d48a6de59620.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology; cDNA library construction,
CC   5'- & 3'-end one pass sequencing and clone selection: Helix
CC   Research Institute (supported by Japan Key Technology Center etc.)
CC   and Department of Virology, Institute of Medical Science,
CC   University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3172
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP4"
FT                   /clone="NT2RP4001790"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        221..2740
FT                   /codon_start=1
FT                   /note="highly similar to Zinc finger protein 95 homolog"
FT                   /db_xref="GOA:B3KNK8"
FT                   /db_xref="H-InvDB:HIT000010986.17"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:B3KNK8"
FT                   /protein_id="BAG51370.1"
FT                   /translation="MIMTGSREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPT
FT                   FETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPE
FT                   EFQPWVREHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPH
FT                   PLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVAD
FT                   VAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHWV
FT                   APEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQST
FT                   HGERGHRCSDCGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGE
FT                   KPYKCQVCGKAFRVSSHLVQHHSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQ
FT                   RCSDKRGKNTKLSVKKKISEYSEADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQGIP
FT                   MKEILGQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKP
FT                   FRCEECGKSYNQRVHLTQHQRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKC
FT                   NECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGIC
FT                   EEAYSWNLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQHYRTHTAEKPYQCDICREN
FT                   VGQCSHTKQHQKIYSSTKSHQCHECGRGFTLKSHLNQHQRIHTGEKPFQCKECGMNFSW
FT                   SCSLFKHLRSHERTDPINTLSVEGSLL"
XX
SQ   Sequence 3172 BP; 924 A; 741 C; 810 G; 697 T; 0 other;
     gggctgtttg aatggctttg ggatggagca ggggagagag tggctccgtt tgcctccccg        60
     ctttggtgat gctgtgcgag cggcttcggg ggccctggag acgtccgagt cactgagggt       120
     gggctgggac tcggggcccg cgtcccatct ccccgccgat tggtccgccc cccgtgcgag       180
     tgtaacacag ccagcctcga agacttccct ctgagttgga atgataatga ccggatcccg       240
     agaagttata gacttagacc ccccagctga gacttcccag gagcaggaag accttttcat       300
     agtgaaggtg gaagaagaag actgcacctg gatgcaggag tacaacccgc caacgtttga       360
     gactttttac cagcgcttca ggcacttcca gtaccatgag gcttcaggac cccgggaggc       420
     tctcagccaa ctccgggtgc tctgctgtga gtggctgagg cccgagctgc acacgaagga       480
     gcagatcctg gagctgctgg tgctggagca gttcctgacc atcctgcctg aagagttcca       540
     gccctgggtg agggaacatc accctgaaag tggagaagag gcggtggccg tgatagaaaa       600
     tatacagcga gaacttgagg aacgcagaca gcagattgtt gcctgccctg atgtgcttcc       660
     tcggaagatg gcaacacctg gagcagtgca ggagtcctgc agcccccatc ccctgaccgt       720
     ggacacccag cctgagcaag cgccacagaa gcctcgtctc ctggaggaaa atgcccttcc       780
     tgttctccaa gttccttccc ttcccctgaa ggacagccag gagctgacag cttcacttct       840
     ctcaactggg tcccagaagt tggtgaaaat tgaagaggtg gctgatgtgg ctgtatcctt       900
     catcctggag gaatgggggc atttggacca gtcccagaag tccctttata gggatgacag       960
     gaaggagaac tatgggagta ttacttccat gggttatgag tccagggaca atatggagct      1020
     catagtgaag cagatttctg atgactctga atcacactgg gtggcgccag aacacaccga      1080
     aaggagcgtt cctcaggatc cagactttgc agaagtcagt gaccttaaag gcatggtaca      1140
     aaggtggcag gtcaacccca ctgtggggaa atcaaggcag aatccttccc agaaaaggga      1200
     tctggatgca atcacagaca tcagccctaa gcaaagcaca catggcgaga gagggcacag      1260
     atgcagcgat tgtggcaaat tcttcctcca agcctcaaac tttattcagc atcggcgcat      1320
     ccacactgga gaaaaaccgt ttaagtgcgg agaatgtggg aagagctaca atcagcgggt      1380
     gcacctcacc cagcaccagc gcgtccacac aggggagaaa ccctacaaat gtcaggtgtg      1440
     cggaaaggct ttccgggtga gttcccacct ggttcagcac cacagtgtcc acagcggaga      1500
     gaggccctat ggctgcaatg agtgtgggaa gaacttcggt cgccattcgc atctgatcga      1560
     acacctaaaa cgccacttca gggagaaatc ccagagatgc agtgacaaaa gaggtaagaa      1620
     cacaaaatta agtgttaaga agaaaatttc agaatattca gaagcagaca tggaactatc      1680
     tggaaaaacc caaagaaatg tttctcaagt tcaagatttt ggagaaggct gtgagtttca      1740
     aggcaagctg gatagaaagc agggaattcc catgaaagag atactaggac aaccatcttc      1800
     aaagaggatg aactacagtg aagtcccata tgtccacaaa aaatcctcca ctggagagag      1860
     accacataaa tgtaacgagt gtgggaaaag cttcattcag agtgcacatc ttattcaaca      1920
     tcaaagaata cacactgggg agaaaccatt caggtgtgag gaatgtggga aaagctacaa      1980
     ccaacgcgtg cacctaactc agcatcagcg cgtccacaca ggtgagaagc cctacacctg      2040
     tcccttatgt gggaaagcct tcagagtgag gtcccacctt gttcagcatc agagcgtgca      2100
     cagtggggag agacccttca agtgtaacga atgtgggaaa ggctttggga ggcgttccca      2160
     cctggctgga catcttcgac tccactcccg agagaaatcc catcagtgtc gtgaatgtgg      2220
     ggaaatcttt tttcagtacg ttagcctaat tgaacatcag gtgctccaca tgggtcagaa      2280
     aaatgaaaaa aatggcatct gtgaggaagc atatagttgg aacttgacag tgattgaaga      2340
     caagaagatt gagttacaag agcagcctta tcagtgtgat atctgtggaa aagcctttgg      2400
     ttatagctca gacctcattc agcattacag aactcataca gcagagaagc cctatcaatg      2460
     tgatatatgt agagaaaatg ttggccagtg ttcccacacc aaacaacatc aaaaaatcta      2520
     ctccagcaca aaatcccatc aatgtcatga atgtggcaga ggcttcactc tgaagtcaca      2580
     tcttaatcaa catcagagaa tccatactgg tgagaaacct tttcaatgta aagaatgtgg      2640
     aatgaatttc agctggagtt gtagcctctt taaacacctg agaagccatg agaggacaga      2700
     tcccataaat accttaagtg tagaggggtc tctgttgtag aatagctctt aattttagag      2760
     aaaccttcct ggagggaaac catactccta taatgagcaa agtaacaact tcaagcattt      2820
     ttccagcgtt accatcaaac tcacaaatag gttgaaatcc tttagttata actcagcctt      2880
     taggaacacc ggagaaccca caataataga aatcttttcg tgttccccat tgagaaatgc      2940
     tttagttagc atcttcatgc ttggaaatct agacaagaag agaatccatg gatggacatg      3000
     gtcgaggaat tcggaaagcc tgcagttgac attcagtctt cacttgaaac tcaaaactga      3060
     cactaggaac agcttcatga gttcagtaga agtaagcttt atttgtagct tctgccttgt      3120
     ttgacggcgt atctattcag ggaagcgcac agtaaaagaa ttccttagca tg              3172
//

If you have problems or comments...

PBIL Back to PBIL home page