(data stored in ACNUC1829 zone)

EMBL: AK027715

ID   AK027715; SV 1; linear; mRNA; STD; HUM; 2942 BP.
XX
AC   AK027715;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ14809 fis, clone NT2RP4001822, weakly similar to
DE   PLATELET-ENDOTHELIAL TETRASPAN ANTIGEN 3.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2942
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (10-MAY-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Ishibashi T., Fujimori K., Tanai H.,
RA   Kimata M., Watanabe M., Hiraoka S., Ishii S., Kawai Y., Saito K.,
RA   Yamamoto J., Wakamatsu A., Nakamura Y., Nagahari K., Masuho Y.,
RA   Kanehori K.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 61123c9dcd9f1243924c8a8bff459f8d.
DR   Ensembl-Gn; ENSG00000157570; homo_sapiens.
DR   Ensembl-Tr; ENST00000340160; homo_sapiens.
DR   Ensembl-Tr; ENST00000520358; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology; cDNA library construction,
CC   5'- & 3'-end one pass sequencing and clone selection: Helix
CC   Research Institute (supported by Japan Key Technology Center etc.)
CC   and Department of Virology, Institute of Medical Science,
CC   University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2942
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP4"
FT                   /clone="NT2RP4001822"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS_pept        49..795
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96SJ8"
FT                   /db_xref="H-InvDB:HIT000010987.18"
FT                   /db_xref="HGNC:HGNC:20660"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96SJ8"
FT                   /protein_id="BAB55318.1"
FT                   /translation="MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIV
FT                   AANPLLLTGAYILLAMGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAIL
FT                   AFIFRENLTREFFTKELTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFKFASVFR
FT                   LLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLA
FT                   GALAIGVLAIELFAMIFAMCLFRGIQ"
XX
SQ   Sequence 2942 BP; 618 A; 936 C; 725 G; 663 T; 0 other;
     ataatccttt tgcaaacatc tcaacgctgg ctctccaggt ggagcaccat ggaaggcgac        60
     tgtctgagct gcatgaagta tctgatgttt gtattcaatt tcttcatatt tctgggcggg       120
     gcctgcctgc tggccatcgg catctgggtc atggtggacc ccaccggctt ccgggagatc       180
     gtggctgcca atcctctgct cctcacgggc gcctacatcc tcctggccat ggggggcctg       240
     ctctttctgc tcggcttcct gggctgctgc ggggccgtcc gtgagaacaa gtgtctgctg       300
     ctatttttct tcctgttcat cctgatcatc ttcctggcag agctctcagc agccatcctg       360
     gccttcatct tcagggaaaa tctcacccga gaattcttca ccaaggagct caccaagcac       420
     taccagggca ataacgacac agacgtcttc tctgccacct ggaactcggt catgatcaca       480
     tttggttgct gcggggtcaa cgggcctgaa gactttaagt ttgcatctgt gtttcgactc       540
     ctgaccctgg atagtgaaga ggtgccggag gcctgctgcc ggagggaacc ccaaagtcgg       600
     gacggggtcc tgctgagccg ggaggagtgc ctcctgggaa ggagcctatt cctaaacaag       660
     cagggctgtt acacggtgat cctcaacacc ttcgagacct acgtctactt ggccggagcc       720
     cttgccatcg gggtactggc catcgagctt ttcgccatga tctttgccat gtgcctcttc       780
     cggggcatcc agtagagggt atggcctgaa gcctgaagac tcgccccacc caccactgcc       840
     cagcacccaa tgtcctcccg tgcccctccc cgctgtcctc ttggccccag gggagaagat       900
     gaggccatca gagatggcca ggagaagggc caggggaata gagctatttt tttaacaaaa       960
     caaaatgagg acaaaaatat ggactgatgt atcctcgcct ggactcaggg caggtgccgt      1020
     gggttctcca gagaccccag cacctggccc aggatgcagg ctgctctaga gaccaaagga      1080
     acaccaggcc cagcgccctc tttggtccag ccagaccctg ggccctctct cctcactgca      1140
     ccaggacctg atgccaagaa agtgaggatt taggcaacaa ggaggcaaaa gcaaatctca      1200
     gagaagtcat caaagcccag gggctgcacg gagattcagc tgccatgtct ttgaggactc      1260
     ggaacccaca gcgcaatccc tggtccactg gaggatggac tgttcccccc ttcaggccgg      1320
     ggccaagagt gagctgctaa cacggcatcc aagaatggcc cagctggtag gatccttgct      1380
     ttccccatct gttggaccaa ataatctcaa aggcccagag aggacagtga ccatccacag      1440
     acacgcagca caggcgtgac agttctgaaa agaagctgag tcgtctccag gctgctgtca      1500
     ctgcatccag gactctgtca gctctgctgc ccacatgcac ccctggcctc agcatcccgg      1560
     ttcccccaga caagagaggg caagtcagcc aggaactgcc tcctccctgc tctacagcta      1620
     agaaaacacc attccatgac ttcccaccgc gccctcgctc ctacctcccc acacctctct      1680
     ctcagtcccc aggaacacac agaggtgcac atcacattcc cttgtccaca ctgcccgcct      1740
     ctcccacatg ccaccccctt ccctgtcctt ccccaactcc ccagctccaa gagtggaaga      1800
     aatccccaag atcatctggg tctccctctc cacacccaga actgaggctt ggatatcttc      1860
     ttcaacatcc ttgccaagac ttctccaccc tcttgcatac ctccagggac agagagctta      1920
     ctacctccca aggcagcctc ctgcctttgg actgctctga ctttagcatc agcttaatac      1980
     acagaagagg tttctgtttt tctgtggctc tgtccatggc atcccacttg cccactctcc      2040
     ttcctggagt gttgaggtca cacattgact cccctgagcc ctcttctctc caggctaaag      2100
     aatcccgaag gcatcgaggc catttctgct gcaacaaggt ttcctgtctc ttcactgtcc      2160
     gcacatttct tagtattccc tccaggcttg ggcagggaga ctcgcagatg cacacccaca      2220
     agtattcagt tctcaaactc tagacgagtg ttggcaactg gattgcaaga tgctcctacc      2280
     ctgatagatc aggggtggct gctggaggct gtgctgggga tctgaggttt ggtctgggct      2340
     cagtgggaga tggcagtgca atcctaatga gtgatgtctg ccaggcaccg taagtttgat      2400
     tagtgatgtc tgccacgggc agggatggaa ggagcagtgt gatgtctgct ctcttctctc      2460
     ccctctgtcc ctcttcagga agaaagagct cattctgtct cacaagccac cggcatcctg      2520
     tatcagcttc cagcctcccc tcaggctttc cagtcaccag ggacactcgg agccacagcc      2580
     tagagccccg tgttccctgg cctgtgcgtc tgcccccttc tgagatgcag ccagaagctc      2640
     tgtgcctgct gcaaagattc aggtggaccc tcctctaatc tcctcctgct gtgcccgcca      2700
     gtccttgccc tcccaccagg tctctgagct cagtcttacc aaattcgccc tttaacagct      2760
     tgctctggca accccataaa tgacacctga gctccgtaga agctaagctc ctgagaccca      2820
     gggggacctg ccactggtac cgcggcccag cctggggcct gggggctgcc cctcttgaac      2880
     cacccacatg cttagcccca gctttttgga agaggcaaat ggctggtctg aggatgacac      2940
     ac                                                                     2942
//

If you have problems or comments...

PBIL Back to PBIL home page