(data stored in ACNUC8465 zone)

EMBL: AK028772

ID   AK028772; SV 1; linear; mRNA; HTC; MUS; 2878 BP.
XX
AC   AK028772;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:4732455E07 product:mitogen activated protein kinase kinase 7, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2878
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 282352d7cbde41ba96b89fb772937180.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4732455E07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2878
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4732455E07"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        46..1653
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 7
FT                   (MGD|MGI:1346871, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="BAC26111.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVI
FT                   TLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSME
FT                   SIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIA
FT                   VKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKL
FT                   KKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGIS
FT                   GRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKN
FT                   CKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHY
FT                   EILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFSTSVTWGAWPLAAQTPFQSGVIRC
FT                   RGRVPSPRRATGGSGGQPCVCAGGPGPSFTEMGPSPSPMLSNTFFTPDPGACPGASTWG
FT                   LPRRRLCQLLTTSTPGCC"
FT   regulatory      2860..2865
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2878
FT                   /note="putative"
XX
SQ   Sequence 2878 BP; 625 A; 878 C; 768 G; 607 T; 0 other;
     tgacgggtgg cctggcggtg agcggcggca gcggcggcgg ggaagatggc ggcgtcctcc        60
     ctggagcaga agctgtcccg cctggaagcc aagctgaagc aggagaaccg tgaggcccgc       120
     aggaggatcg acctcaactt ggatatcagc ccacagcggc ccaggcccat tattgtgatc       180
     actctaagcc ctgctcctgc cccgtcccag cgagcagccc tgcaactccc actggccaac       240
     gatgggggca gccgctcacc atcctcagag agctccccac agcaccctac accccccacc       300
     cggccccgcc acatgctggg gctcccatca accttgttca caccgcgcag tatggagagc       360
     atcgagattg accagaagct gcaggagatc atgaagcaga cagggtacct gactatcggg       420
     ggccagcgtt atcaggcaga aatcaatgac ttggagaact tgggtgagat gggcagtggt       480
     acctgtggtc aggtgtggaa gatgcggttc cggaagacag gccacatcat tgctgttaag       540
     caaatgcggc gctctgggaa caaggaagag aataagcgca ttttgatgga cctggatgta       600
     gtactcaaga gccatgactg cccttacatc gttcagtgct ttggcacctt catcaccaac       660
     acagacgtct ttattgccat ggagctcatg ggcacatgtg cagagaagct gaagaaacga       720
     atgcagggcc ccattccaga gcgaatcctg ggcaagatga ctgtggcgat tgtgaaagca       780
     ctgtactatc tgaaggagaa gcatggcgtc atccatcgcg atgtcaaacc ctccaacatc       840
     ctgctagatg agcggggcca gatcaagctc tgtgactttg gcatcagtgg ccgccttgtt       900
     gactccaaag ccaaaacacg gagtgctggc tgtgctgcct atatggctcc cgagcgcatc       960
     gaccctccag atcccaccaa gcctgactat gacatccgag ctgatgtgtg gagcctgggc      1020
     atctcactgg tggagctggc aacaggacag ttcccctata agaactgcaa gacggacttt      1080
     gaggtcctca ccaaagtcct acaggaagag cccccactcc tgcctggtca catgggcttc      1140
     tcaggggact tccagtcatt tgtcaaagac tgccttacta aagatcacag gaagagacca      1200
     aagtataata agctacttga acacagcttc atcaagcact atgagatact cgaggtggat      1260
     gtcgcgtcct ggtttaagga tgtcatggcg aagaccgagt ccccaaggac tagtggagtc      1320
     ctgagtcagc accatctgcc cttcttcagc acctctgtta cctggggcgc ctggcccctg      1380
     gctgcgcaga ccccttttca gtctggagtt atcagatgca gaggacgcgt tccctcgccg      1440
     cgcagggcca ctggaggttc cggcggacag ccatgtgttt gtgcaggcgg ccctggcccg      1500
     tccttcaccg agatggggcc tagcccttca ccgatgctca gtaacacctt cttcacgccc      1560
     gaccctgggg cctgccctgg tgcttctacg tgggggctgc cccgccgacg actctgtcag      1620
     cttctcacca cctccacgcc cggatgctgc tagcgtctca cgcttcagct ttcgcctgcg      1680
     tccggtattc aatgcctcag tacagttctt gcactgccag atcagccgtt gccgccgtcg      1740
     cagcagtcac caccgccgag ctgtccgcct gacaccagtg cctttgaccc caccagcacc      1800
     attgcggtgt ctgcctcagg atgaggcatg tgcgggcagc agcttgagcc ttggtaccga      1860
     cagcccccac ctgcacatgc tgacacagcc catcgtggtc acaatacctc gtccgtcccc      1920
     taggccatcc aagagtctcc caggcaggtc ggtacacccg gagccacccg ctccagcccc      1980
     tgcagcactg gagcctgcac cggtggtggc attggtgttg gcggccttcg tgctgggtgc      2040
     tgcgctggcc gctgggcttg gtctcgtctg cgcacactca ggtactgact tctgctccgc      2100
     cagaacccca cacctatttc cacacgttca gacagtctag tagtctacct gccccacccc      2160
     caaccccgtg agcccatatc cctgaacctg cctccaggat caggccctta gggctggtac      2220
     acttgtagca gctcccacca gggggcgcgc ttaatctggc gcagggcaca ggcaactcct      2280
     attctagcta gcttcttctt tcagcacccc cacccccagg cccgcctcct agagcttctc      2340
     tcagcggccc ccagctccag agacccccag taggcaggta agtactgggt gtgaaggtct      2400
     gaagcaagag ctatgagaag ggcatggtgg taaggatcgt tcttagagtt tactcatggg      2460
     actccaagta ctttgtgcat tcatttaatc ttcttttgaa caacattcag atagatagaa      2520
     gaagaatgct tttatgaggc taagtaactt gtcaaaggtg gagctgcaaa tggaatttgg      2580
     gagatggggt cccgagcagt gaccgaacgg ggtctttagg acttgaacag atatgtaaga      2640
     gggatttata cagttttagt ttcacacacc ccaatacata gattggtgaa ggaagccaaa      2700
     gcttgttggg agaatgtgac ctgagcctct gtcaccccct ctcccccaga gatggcacca      2760
     cccagtgagg tcctgagatc cactcagccg tggtttaccg ttcagaaggc ctcctgcgtg      2820
     tcttctctcc cctctccctg tcctcactcc cctgttcaaa ataaattggt gacctgcg        2878
//

If you have problems or comments...

PBIL Back to PBIL home page