(data stored in ACNUC31108 zone)

EMBL: AK028808

ID   AK028808; SV 1; linear; mRNA; HTC; MUS; 3374 BP.
XX
AC   AK028808;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:4732457O14 product:weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
DE   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1) (CD151 ANTIGEN)
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3374
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 72ddc8d91bcd8ce0994af4b4761a3fd1.
DR   Ensembl-Gn; ENSMUSG00000030351; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031124; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030485; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032501; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080398; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079051; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4732457O14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3374
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4732457O14"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        160..921
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
FT                   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1)
FT                   (CD151 ANTIGEN) [Homo sapiens] (SWISSPROT|P48509, evidence:
FT                   FASTY, 59.2%ID, 94%length, match=714)"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="BAC26129.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
XX
SQ   Sequence 3374 BP; 790 A; 937 C; 900 G; 747 T; 0 other;
     gagtctgagt gagaggggca gccagcagcc accgcgggcc agtgggcaag gagcgcaggg        60
     tggagcgggc ggctgtggcc aggacagcca caatcacagc tccggattcc cgatccctcg       120
     ctgcatccag cctggcggtt ttggccgggt ccagccgcca tggcgcactg caagacagag       180
     caggatgact ggctgctggc ccacctgaag tacctgctct tcatcttcaa cttcttcttc       240
     tgggtaggtg gggcagccgt catggccgtg ggtatctgga cactggtgga gaagagcggt       300
     tacctcagca tcttggcctc cagcacgttc gctgcctctg cctacatcct cattttcgtt       360
     ggtggtcttg tcatgacaac tggcttcctg ggctttgggg ccatcatccg ggagcagaag       420
     agctgcctct ccacatattt ctgcctgctg ctggtcatct tccttgtgga gctggtggca       480
     ggggtcctgg cacatgtgta ctaccagagg ctgagtgacg agctgaagtg gcacctgaac       540
     agcaccctga ctgagcacta cggacagccc agggccgcag agatcacagc ctcggtggac       600
     cggctgcagc aggacttcaa atgctgtggc agtaacagct cagccgactg gcagcacagc       660
     gcgtacatct tgtctcagga agccctgggt cgccaggtgc ccgacagctg ctgcaagaca       720
     gtggtggccc gctgtggtca gcgagcccac ccctccaaca tctacaaggt agagggaggc       780
     tgtatggcca agctggaaca gttcgtggct gaccacctgc tgctcatggg agcggtgggt       840
     attggggtag cctgtcttca gatctgtggg atggtcctca cctgctgctt gcaccgaagg       900
     ctccagcaac aattttatta aaggacaccc atgtaccctg ctgactggcc cacccaaggg       960
     accacatctc cacttcctga accaggcctg caaagtcatc gctggggctg tggactcgct      1020
     ccaccctatg cagaggccac caaatgtctg tggttgtggt tcctgtgcat cccgactggc      1080
     aggggcctca gctaactcct ccattcctaa gtactcagcc actgccaaaa tccttgccaa      1140
     gggatgatcc tggccagagg cagccagagc cctttgccag gcactgggac gctgtggact      1200
     acaggggggc cagagctcat ctccctctga tccatctcag tgtctgagtc tggaatagaa      1260
     ggccgtcgga tggtccctct gagagtccta tagggcttgg cgtgtgattc ccactggcat      1320
     gtggccccag gctggctctc ctttgggaaa accagcactt tgggcagacc aggttagctc      1380
     agccttttcc aaaacctggc tggtttttca atctctccac agaatagctg gccaagacct      1440
     tcctgtaagg tatagggcag aagtgatcaa aggtggggca tcttaaggta gctgttgaag      1500
     ccaacagcac agggcactaa ggaagcaggt tggtcacaac acctaggaaa gtcacacgat      1560
     ggtcacaatc cccagcctct ggtcctgttc ccaggcttga cttccaaaat gtcaggctta      1620
     aaatgttagt gaatgtaaaa ctatctcctc gaccaggtgg ggggcacacc acagtctcag      1680
     ctgctgagga gaggatgcga cgctacgggg aaggaggaac tctgcctgca ccccatctcc      1740
     tggtgccctt gtgacctcac tgtttctctt ccatgcattc tccacttcct tgtccactgt      1800
     gctggagtag atgccggccc ttccttcgct cctctcttta gtcacggaat gacacaggag      1860
     attcaaggag aactcatgtg ttaaaagaca cggaaagaaa attctagaaa aattaaaggt      1920
     tgatagtagg tatcatagac aaccataggg acccccctgt gattattatt actgtaggca      1980
     gctttgcaca ccagggctcc actcctagct tcagtcttcc ctgcttgggt cctgctcatc      2040
     tctctacaat aacaaacctc agttccgaca tgaaccagca gcagcagcaa aaagtgtcca      2100
     actggttgtc tacctggctc agttctcact gtggtgaccc cagatcctgc tgatctgggt      2160
     caattgttgg agagagatga gctcccaccc acacatgggt ggactaaggg ccactggttg      2220
     cagtcaccag cacaggtgga attccactct cagggcagga agtagctgtg tgcacagagg      2280
     gaacatcagg ctctcaggtc agacagcctc ctacacactg gcgttctcca ggggctactc      2340
     ggagcctgga ctggcttata ttattcacct gaaggaccaa cactaagaag aagacactca      2400
     ctccccaaaa tcccagacta cactacatat ggctcagaga aaaacctcag cttcctccac      2460
     cttcccagga ttcacgcaga tactcagact ggctgtggtt ccgaagcttg tagatggagg      2520
     atggagaaga aaagtggtgg ggcccaggta atgttctccc caaaaaggca ctgagggagg      2580
     tgatagtgtg caaaggaata ctgtggcctc aggcatctgc tttggtaggc tcatcaggga      2640
     gatgaggtca gaggtgataa gcagccactg ttggtacaga cttgatgcag aggtagtcca      2700
     ggagagcatg aggcatccac tcagtcagag ccacagagtg agcagacagc cccaaatgtg      2760
     actaccttga ccatacatca gccttggtga caagatgggg tgagaggaca tgaagcacat      2820
     agtaggccag gttcgttcca gcagcttcga aggctggagc caagtctgta gtgaggtgtc      2880
     cccaacagtt tcatgccaga gtatttctac ctatttccca ctcagggacg gggccctgtt      2940
     ccgaggttat cggtctggat ttcttagaga aagggaagga cacacctgta gaatgtcacc      3000
     ctcagtcctg ggtcagcaca aaacatactg gggtcccatg ccaggccctg aacttggtgt      3060
     agctcaagcc agtggaccct cattctaagc atataagtga gccaccattc cctaaactca      3120
     aagtggccac ctcaaaaaca cagcccaccc ctaaatcccc cagtgaccag tattggggaa      3180
     caaggatgga ccttagtcta tgacatcaga tggggtgtct ccatgcattc gtccctttcc      3240
     ctccccaaca gtgcatcccc accctcaccc catagcacca ttggcatgta tatattcttc      3300
     actatgctat tcatagtgac accaacggga tgtgctatag tccccattct gttgatgaag      3360
     aaactaaggc ttgg                                                        3374
//

If you have problems or comments...

PBIL Back to PBIL home page