(data stored in ACNUC21562 zone)

EMBL: AK029369

ID   AK029369; SV 1; linear; mRNA; HTC; MUS; 2075 BP.
XX
AC   AK029369;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate head cDNA, RIKEN full-length enriched library,
DE   clone:4833406I20 product:MrgB2 G protein-coupled receptor, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2075
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0e8deb3d88b6b2b6000fda82f0ef065f.
DR   Ensembl-Gn; ENSMUSG00000050425; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031961; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052730; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084043; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083661; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082715; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4833406I20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2075
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4833406I20"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        68..1084
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="MrgB2 G protein-coupled receptor (SPTR|Q91ZC2,
FT                   evidence: FASTY, 99.7%ID, 100%length, match=1014)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="BAC26422.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYFDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
FT   regulatory      2059..2064
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2075
FT                   /note="putative"
XX
SQ   Sequence 2075 BP; 556 A; 410 C; 373 G; 736 T; 0 other;
     gagaggactc ttctctttgt cacagaccag tttaacactt cccataagaa gaatagagca        60
     aaggaacatg agtggagatt tcctaatcaa gaatctaagc acctcagcct ggaaaacgaa       120
     catcacagtg ctgaatggaa gctactactt cgatacttca gtttgtgtca ccaggaacca       180
     agccatgatt ttgctttcca tcatcatttc cctggttggg atgggactaa atgccatagt       240
     gctgtggttc ctgggcatcc gtatgcacac gaatgccttc actgtctaca ttctcaacct       300
     ggctatggct gactttcttt acctgtgctc tcagtttgta atttgtcttc ttattgcctt       360
     ttatatcttc tactcaattg acatcaacat ccctttggtt ctttatgttg tgccaatatt       420
     tgcttatctt tcaggtctga gcattctcag caccattagc attgagcgct gcttgtctgt       480
     aatatggccc atttggtatc gctgtaaacg tccaagacac acatcagcta tcacatgttt       540
     tgtgctttgg gttatgtcct tattgttggg tctcctggaa gggaaggcat gtggcttact       600
     gtttaatagc tttgactctt attggtgtga aacatttgat gttatcacta atatatggtc       660
     agttgttttt tttggtgttc tctgtgggtc tagcctcacc ctgcttgtca ggatcttctg       720
     tggctcacag cgaattccta tgaccaggct gtatgtgact attacactca cagtcttggt       780
     cttcctgatc tttggtcttc cctttgggat ctattggata ctctatcagt ggattagcaa       840
     tttttattat gttgaaattt gtaattttta tcttgagata ctattcctat cctgtgttaa       900
     cagctgtatg aaccccatca tttatttcct tgttggctcc attaggcacc gaaggttcag       960
     gcggaagact ctcaagctac ttctgcagag agccatgcaa gacacccctg aggaggaaca      1020
     aagtggaaat aagagttctt cagaacaccc tgaagaactg gaaactgttc agagctgcag      1080
     ctgacaactg cttgatcaga caaaaatggt tttgatggaa atactttttc ttatccgtgt      1140
     ggaccatttt tacaaccttt attcagtttg ttatctcatc ttcaattgtt taattaggac      1200
     aataattttt gtaaaagttg agagaaatgg gtcttgtcat actaatactg aatgtagcat      1260
     ttctgaagct gtgttactta gggatttacc atctcctttt catgggactc cttgtaagta      1320
     ttctgtggta gagaacttct cctattgttg acaaactctc ctttagaagg caaatggaaa      1380
     tacaaggaag ggctgtattt ctttacccac tgaaatgtat aatgagtaca caaatgttac      1440
     atctagcaaa tattctttta gaacaccctt ctcaatgttt aagacttaaa tagaaacact      1500
     ttataatcct agtccttatt aatttcttca ggttataaag aatatatgaa gtgatagttt      1560
     ttttacgtaa attttttact aaacaaataa aatttctcaa aagaagactg ttaaatctct      1620
     cttaacccag ctgagtcctc actgtgaaca tcaagttcac tgtgtctcta atttttaaaa      1680
     tttgaagagt gcacttagat ttggcaatga gatccatcaa aatccatgtc cacatgaagg      1740
     tgaagagagt cagacttctg tgtttctctt cacaatgcct tctttagcat tccatggtcg      1800
     agtgttttcc ctttactccc tgcctttgct gtgatttctg ctctctctga ctgtctaatt      1860
     cttcatgaga agtttccact aggtcctcta gacaatcctg tctcaaattt aaatcaccct      1920
     cagataattt attatgtgaa tttgttactt gcattgataa caatcattgt aattgaatat      1980
     gaatattttt tgtaacactt tctataaaat aatatttgtt tttaagctgt actatgtgat      2040
     attttcagtt gaagcataat taaaagagtt caacc                                 2075
//

If you have problems or comments...

PBIL Back to PBIL home page