(data stored in ACNUC13479 zone)

EMBL: AK030437

ID   AK030437; SV 1; linear; mRNA; HTC; MUS; 2992 BP.
XX
AC   AK030437;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male pituitary gland cDNA, RIKEN full-length enriched
DE   library, clone:5330411O16 product:signal recognition particle receptor beta
DE   subunit mRNA, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2992
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 63d50e77cab64dbf3a49310434d9b212.
DR   Ensembl-Gn; ENSMUSG00000032553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035174; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034189; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034846; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034309; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035157; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094009; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093962; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094449; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093641; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093471; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0093547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092509; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5330411O16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2992
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5330411O16"
FT                   /tissue_type="pituitary gland"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        8..817
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor beta subunit
FT                   mRNA (GB|U17343, evidence: BLASTN, 100%, match=836)"
FT                   /db_xref="GOA:P47758"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="PDB:2FH5"
FT                   /db_xref="PDB:2GO5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47758"
FT                   /protein_id="BAC26963.1"
FT                   /translation="MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
FT   regulatory      2977..2982
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2992
FT                   /note="putative"
XX
SQ   Sequence 2992 BP; 708 A; 768 C; 782 G; 734 T; 0 other;
     gtctttcatg gcttcggcga acacccggcg agttggcgat ggcgccggtg gcgccttcca        60
     gccttacctc gactccttac gacaggagct gcagcagagg gatccgacgc tgctctccgt       120
     ggcggtggct ctcctggcgg tgctgctgac gctggtgttc tggaagttca tctggagccg       180
     aaagagcagt cagagagctg ttctcttcgt tggtctctgt gactctggga aaacgttgct       240
     gtttgtcagg ttgctaactg gccagtacag agacacacag acttccatta ccgatagttc       300
     tgccatatac aaagtcaaca ataacagggg taacagcctg actctgatcg acctccccgg       360
     gcatgagagc ttgaggtttc agctcttaga tcgctttaag tcttcagcta gggctgtggt       420
     gtttgtggtg gacagtgcgg cgttccagcg ggaggtgaaa gatgtggccg aatttctgta       480
     ccaggtcctc atcgacagca tggctctgaa gaactcaccg tccttattaa tagcctgcaa       540
     taagcaagat atcgcaatgg caaaatcagc gaagttgatc cagcagcagc ttgagaagga       600
     gctcaacacc ttacgagtca cccggtccgc ggctcccagc acactggaca gttccagcac       660
     cgcacctgct cagttgggga agaaaggcaa agaatttgaa ttttcccagt tgccactcaa       720
     agtggagttc ctggagtgta gtgccaaggg tggacgaggg gacactggct ctgctgacat       780
     ccaggacttg gagaagtggc tggccaagat tgcctgagga gcatcgctgg ccacaagcgt       840
     tggtcatgtg agactgaccc tgcagtttga gaaagggcgg tggtggtgtg gactgataaa       900
     gagggggcat gtcgttgaag catttcttga gttcttgaaa caattgtacc acccccaccc       960
     cacccccgtc agctcctttc tcagctagtc ctttcttaat tcccatattc tttctccctt      1020
     tgctaggtgt taggtgtagc atcatgttag tgtgagacat aacagagagg gcatcgcttt      1080
     gagagtaggg tcgcatctga gaagtccttg tctcctgcct ctgtgttggt cccttttcct      1140
     gggaccagat ctgcctgctt gtggaataag tgaacttgca gttgcccctg gtgtaggcat      1200
     aatacagtgt cagttcttag tggagtctgg ggtgtgaagg tctacagtga agacagcttc      1260
     aaagccacag gcacagctga cagtgtgtcc ttcacgggct cagtgaccat cccacaccac      1320
     cctagctgac agtgtgtcct tcacgggctc ggtgaccatc ccacaccacc ctagctgaca      1380
     gtgtgtcctt cacgggctcg gtgaccatcc cacaccaccc tagctgacag tgtgtccttc      1440
     acaggctcgg tgaccatccc acaccaccct agctgacagt gtgtccttca tgggctcggt      1500
     gaccatccca caccacccta gctgacagtg tgtccttcac gggctcggtg accatcccca      1560
     caccacccta ggttcaaaag ctgccgcaac cccgaagagt caccctcaca aggtggctct      1620
     aggagccaaa tccccagaca ctcctaggtt agtgttctag aggctccact ggggagagca      1680
     gggagacagc acactgctgc ctcgggcgtg cgtgagccca ggctgtcccc tgtgctactt      1740
     gatcagctcc tgttgtgtca ccccagctag agtgctatgg aacaatacaa actgaagatg      1800
     tccactgtgc attttaaata catatttatt catgatgctt taaaaaatgt taccttttta      1860
     aagtgatgct gtcttcaaca tttgtgttct cattgctttt ataaatgact ggtatcttga      1920
     taaatgacta tactgaaagc attgagtcaa atgatgagta caagtgggaa cctgagctag      1980
     aattgaaccc cagctccagg ttactgagcc tacagatcgc tgcatatatg agactcttgg      2040
     tctcgtctca cactcagagt caggcttcac taaagccaca ctaaagagac aggcagagca      2100
     ttgactcagg tgcagtgctc agggaatatg tgtggcgctc tgggctggcc tggaccagtg      2160
     agagggacag gataaacaca caggtgttct ctgtgcagac cagcccaagc ctctgcctgc      2220
     tgacacatgg cctccctgtg ggtcacctgg gctgataata gagtcccaga ccatgattcc      2280
     catcaagtac tcagctcccc actcctaaaa tatctactgg ccttgcttat ggtgtatgag      2340
     acagatacag cacagcacag gacagataag ccatgagatg actcagttct cactgggagg      2400
     cagtattgct gctaggattc ttactgccct ttgcacactg ctgttcatgt tggtcacgga      2460
     caaatgggaa gggcacgatg aaggacgttc acatcacagt aggtgctcat caaaaaaacc      2520
     tttcagttag aaaatgtgtt cgctggcctc ccttttgtct gcataataaa gtgattttac      2580
     ttagtgggag aatcagtaca tcaaaaaagt gacaaggatg gagagcaagg ataaatgtta      2640
     tttatttatt tatagcctgt gtcctgagca aaaggtaagc tgtgcagggc tgggaaccag      2700
     gttagtagaa tgcctacctg gaacgcatgg gtctggcttt gctgtgggct gctgtaaaag      2760
     ccagctctaa acaggcagcc gcagcaaaga ttctatgtct ggactcttcc atggagccac      2820
     ggcagaagca gcttctcact gctaggtgcc ttgtggtctc tcgggaggcc ttggcccctg      2880
     ccactgcttc ccagggcctc cagcacctcc tgacgtgagc tgttctatca gaggggaggg      2940
     gaggcagtgg cccagccatt gagctatttc aggcacaata aaatataagg ct              2992
//

If you have problems or comments...

PBIL Back to PBIL home page