(data stored in ACNUC8465 zone)

EMBL: AK031137

ID   AK031137; SV 1; linear; mRNA; HTC; MUS; 2703 BP.
XX
AC   AK031137;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 13 days embryo forelimb cDNA, RIKEN full-length enriched
DE   library, clone:5930412N11 product:mitogen activated protein kinase kinase
DE   7, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2703
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; aa30797c3cd902d4825498df2f027a76.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5930412N11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2703
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5930412N11"
FT                   /tissue_type="forelimb"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        80..1339
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 7
FT                   (MGD|MGI:1346871, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="BAC27272.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQL
FT                   PLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
FT                   YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKKMRRSGNKEENKRI
FT                   LMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKM
FT                   TVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCA
FT                   AYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP
FT                   PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMA
FT                   KTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 2703 BP; 597 A; 753 C; 783 G; 570 T; 0 other;
     ggcaggcgct gtgcggtgtt tgtctacccc ggactgacgg gtggcctggc ggtgagcggc        60
     ggcagcggcg gcggggaaga tggcggcgtc ctccctggag cagaagctgt cccgcctgga       120
     agccaagctg aagcaggaga accgtgaggc ccgcaggagg atcgacctca acttggatat       180
     cagcccacag cggcccaggc ccaccctgca actcccactg gccaacgatg ggggcagccg       240
     ctcaccatcc tcagagagct ccccacagca ccctacaccc cccacccggc cccgccacat       300
     gctggggctc ccatcaacct tgttcacacc gcgcagtatg gagagcatcg agattgacca       360
     gaagctgcag gagatcatga agcagacagg gtacctgact atcgggggcc agcgttatca       420
     ggcagaaatc aatgacttgg agaacttggg tgagatgggc agtggtacct gtggtcaggt       480
     gtggaagatg cggttccgga agacaggcca catcattgct gttaagaaaa tgcggcgctc       540
     tgggaacaag gaagagaata agcgcatttt gatggacctg gatgtagtac tcaagagcca       600
     tgactgccct tacatcgttc agtgctttgg caccttcatc accaacacag acgtctttat       660
     tgccatggag ctcatgggca catgtgcaga gaagctgaag aaacgaatgc agggccccat       720
     tccagagcga atcctgggca agatgactgt ggcgattgtg aaagcactgt actatctgaa       780
     ggagaagcat ggcgtcatcc atcgcgatgt caaaccctcc aacatcctgc tagatgagcg       840
     gggccagatc aagctctgtg actttggcat cagtggccgc cttgttgact ccaaagccaa       900
     aacacggagt gctggctgtg ctgcctatat ggctcccgag cgcatcgacc ctccagatcc       960
     caccaagcct gactatgaca tccgagctga tgtgtggagc ctgggcatct cactggtgga      1020
     gctggcaaca ggacagttcc cctataagaa ctgcaagacg gactttgagg tcctcaccaa      1080
     agtcctacag gaagagcccc cactcctgcc tggtcacatg ggcttctcag gggacttcca      1140
     gtcatttgtc aaagactgcc ttactaaaga tcacaggaag agaccaaagt ataataagct      1200
     acttgaacac agcttcatca agcactatga gatactcgag gtggatgtcg cgtcctggtt      1260
     taaggatgtc atggcgaaga ccgagtcccc aaggactagt ggagtcctga gtcagcacca      1320
     tctgcccttc ttcaggtagc ctcatggcag cggccagccc cgcaggggcc ccgggccacg      1380
     gccaccgacc ccccccccaa cctggccaac ccagctgccc atcaggggac ctgggacctg      1440
     gacgactgcc aaggactgag gacagaaagt agggggttcc catccagctc tgactccctg      1500
     cctaccagct gtggacaaaa gggcatgctg gttcctaatc cctcccactc tggggtcagc      1560
     cagcagtgtg agccccatcc caccccgaca gacactgtga acggaagaca gcaggccatg      1620
     agcagactcg ctatttattc aatcataacc tctgggctgg ggtaaccccc aggggcagag      1680
     agaaagcccc ttgtccccat ccccccaaac tcccagtgtc tgtcccctcc accttctctc      1740
     gcacacatgc ttgctctacg tctttccttc tgtcccctcc ctctctacca ctgtcccttt      1800
     ctggttcccc tgtctccctc ccagcctctg aagcctgggt gccgccactc taccctcagt      1860
     ggaaggaagc cccaggttca tctaggcttc cttaagtctt tgtcctagga tggctttgtg      1920
     ggcattgtga ctgcagccaa atggttgctg tctctgtgtc tgtctgtctc tctttgatct      1980
     cagggggtcc ttttggagtt tattgtattt tattgtactt ggtgggggtg tgttgggggg      2040
     ggggtgtcct catggggtcg gtacccttca gaaaatttta ccaaagtaat gtttagctgc      2100
     ttgtggtggc cccctctcct ccattgcctc aggcattggg ggttggactg cttgctgctc      2160
     cttgtcattt ctggcctagg agaggccagg ctccatgggg gaccctcaca tgggactggg      2220
     agctgctgac agtttggggt tgagtagaag agctcaggtg gcacagaggg agaccagggg      2280
     cctcagccac acgatggcct tcagggaagg tgtatgaggg atgcagtaga gagtagcagg      2340
     tagcagggag ggactgttgg gaacagtgac aggagggaat cctgccaagg ggcaggaggg      2400
     gtcccgagaa gtcagggatt aggagtgaag ggagtagatg tggaggtccg agcatgtgaa      2460
     tcagggacga gacggacagg cgtgaatgca ggggaggcca gagtattggg atgcgacgcg      2520
     acttactccc aacatgcccc tgagcatgct ttagctcacc tagagctgac cagctccaac      2580
     ccaacctgtg gcctggactg ggccaggtgc ctgtcccatt gtcctgcagt ttcgaggaca      2640
     gagtggggta tgtttccttt ttgttggtga tgcatgcagt tcaagtggac aagagaacaa      2700
     tat                                                                    2703
//

If you have problems or comments...

PBIL Back to PBIL home page