(data stored in ACNUC3292 zone)

EMBL: AK032601

ID   AK032601; SV 1; linear; mRNA; HTC; MUS; 3448 BP.
XX
AC   AK032601;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430630P06 product:sperm associated antigen 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3448
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c85b7df4bdc75b238d1c4d2f79ba4f37.
DR   Ensembl-Gn; ENSMUSG00000037617; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021753; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022198; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021050; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021629; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022221; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020794; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021106; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000047348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171205; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040760; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040759; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041227; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040548; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040529; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040630; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040514; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040140; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039901; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430630P06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3448
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430630P06"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1146..2735
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="sperm associated antigen 1 (MGD|MGI:1349387
FT                   GB|NM_012031, evidence: BLASTN, 99%, match=2987)"
FT                   /db_xref="GOA:Q80ZX8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025986"
FT                   /db_xref="MGI:MGI:1349387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80ZX8"
FT                   /protein_id="BAC27944.1"
FT                   /translation="MGNIQKKLMVRRSEGGRRSRRGRTPGPRAEQQGGLRETATASTGD
FT                   SHYPEEPRAADNPSGLKRRGNELFRGGQFAEAAAQYSVAIAQLEPTGSANADELSILYS
FT                   NRAACYLKEGNCRDCIQDCNRALELHPFSVKPLLRRAMAYETLEQYRNAYVDYKTVLQI
FT                   DCGIQLASDSANRIARILTELDGSKWRERLPPIPAVPTSEPLRVWLPAAETPDQDPCPN
FT                   NCMPSITDEKMFQALKEEGNQLVKDKNYKDAISKYNECLKINSKACAIYTNRALCYLKL
FT                   GQFEEAKLDCEQALQIDGENVKASHRLALAQKGLENCRESGVDPSQVLLSPDSSEAARH
FT                   LDTKNDTAPPSKGRERRRIQVQEVDGSSDEEPERPAEASATSAPARDGVEDGGSAEPAE
FT                   KLDVSKPTNAYEFGQVLSTISARKDEEACAHLLAITAPKDLPLLLSNKLEGDTFLLLIQ
FT                   SLKSHLVAKDPSLVYEHLLYLSKAERFKTMLTLINKGQKEQMAQLFDGLSDTQSDGLTA
FT                   EDVQALRRQYEL"
FT   regulatory      3429..3434
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3448
FT                   /note="putative"
XX
SQ   Sequence 3448 BP; 1034 A; 757 C; 890 G; 767 T; 0 other;
     gacacagcca tcagtaagag gggatcagca ggcagggagg acacacagcc atcagtaaga        60
     gggggtcagc aggcagggag ggcacacagc catcagtaag aggagggggt cagcaggcag       120
     ggaaggcaca cagccatcag taagagggga tcagcaggca gggaggacac acagccatca       180
     gtaagagggg gtcagcaggc agggagggca cacagccatc agtaagaggg ggtcagcagg       240
     cagggaggac agggtctctg aagagagcag aaacaggaaa gtcctcccca gcagacctgg       300
     gcctcttttg ctgttgttgt tattgttatt tttgtttggt tggtttttgt tttttggaat       360
     tagtttaagt tggatgtctg cctgacaaac aaaacaaccc ttcctaatcc agcaaagtcg       420
     ttactcttgt ctctctcagt gcctcggctc taaaagaatg ggaaacatat tctaaaagta       480
     agacagctaa gaagaggatt ccaagggatt atgcagaatg ggataaattt gatgtggaaa       540
     aagaatgttc aaagattgat gaggattaca aagaaaagac tgtcataaac aacaaggctc       600
     atctgtctaa aattgagaca aaaatagaaa cagcaggtct gactgagaag gaaaagagtt       660
     ttcttgccaa tcgtgaaaag ggaaaaggga acgaggcttt ctactctggg gactatgaag       720
     aggccgtgat gtattacacc aggagcttat cagcccttcc caccgccatt gcctataaca       780
     atcgagctca ggccgaaatc aagttgcaga gatggagcag tgctcttgaa gactgtgaga       840
     aggccttgga gctagatccc ggaaacgtaa aagctctcct gagacgagcc actacatata       900
     aacatcaaaa caagctccag gaagctgtgg acgacctgag aaaggtgctg caggtggagc       960
     cggacaacga cttggccaag aagaccttat cagaggttga aagagatctg aagaattcag      1020
     agcctgtctc tgagctccaa accaaaggga agaggatggt tattgaagaa gttgaaaact      1080
     cgggagatga aggtggaaag ggaagcgcag atgagcgtga agatggtggc tcggatgagg      1140
     cggccatggg caacattcag aagaagctga tggtccgccg gagcgagggt ggcaggcggt      1200
     cgcggcgggg ccggacaccg gggccccgag ctgagcagca gggaggcctg cgagagacag      1260
     cgacggccag caccggcgac agtcactacc cggaggagcc gcgagccgct gacaacccca      1320
     gcggcctcaa gagacggggc aacgagctgt tccgcggcgg gcaattcgca gaggcagccg      1380
     cgcaatactc ggtggcgata gcgcagctgg aacccacagg aagtgcaaat gcggatgagc      1440
     taagcatctt gtattcaaat agagcggcat gctacctcaa agaagggaac tgcagggact      1500
     gcatccagga ttgtaacagg gctctggaac ttcatccgtt ctcagtgaag cctcttctgc      1560
     ggcgagcaat ggcctatgag accttagagc aatacaggaa cgcatatgtg gactataaaa      1620
     cagtgctgca gatagattgt gggatccagc tggcgagcga cagtgctaac agaatagcac      1680
     gaatcttaac agagctagat ggatcaaaat ggcgggagag actgccaccc atcccagctg      1740
     tacccacatc tgagccactg cgagtttggc tccctgctgc agagacccca gaccaagatc      1800
     cctgtcccaa caactgcatg ccgagcatca cagatgaaaa aatgtttcaa gccctcaagg      1860
     aagaaggaaa tcaacttgta aaggacaaaa attataaaga tgccattagt aaatacaatg      1920
     aatgcttaaa gattaacagc aaggcatgtg ccatctatac aaacagggct ctctgttacc      1980
     tgaagctggg ccagtttgaa gaggcaaagc tggactgtga gcaggcgctt cagatagacg      2040
     gcgagaatgt gaaagccagc cacagactag cgctcgccca gaaaggactc gagaactgcc      2100
     gggaaagcgg ggtggacccc agtcaagtcc tcctaagccc agattccagt gaagccgccc      2160
     ggcacctgga cactaagaat gacacagcac ctcccagcaa aggaagggag aggaggagaa      2220
     tccaagtcca agaggtggat ggcagcagtg atgaggagcc tgagagacct gcagaggcct      2280
     ctgctacctc cgcacctgcc agagatggtg tggaagatgg agggtctgca gaaccagcag      2340
     aaaaactcga cgtctccaag cctactaatg cctatgagtt tggacaggtc ctaagcacta      2400
     tcagtgccag gaaagatgaa gaggcctgtg cacatctttt agccatcact gcacccaaag      2460
     acctgccact gttgctaagt aacaaacttg agggggacac gttcctcctc ctcattcagt      2520
     cacttaaaag tcaccttgtg gctaaagacc cctccctggt gtatgagcat ctcctgtatc      2580
     tgagcaaagc agagaggttt aagacgatgc tgacactaat taacaaaggc caaaaggagc      2640
     agatggcgca gctgtttgat ggtctgtcag acacacagtc cgacggtttg acggcagagg      2700
     atgtacaggc cctaagaagg cagtatgagc tttaacttgg ggttgctgag ttcaagacag      2760
     caaacattgt gatgcagttg catgggtaaa gccacaccca gaaggatccc tgtttggaca      2820
     tcagatgttg tacttatttt tatatctaga acatgtatat tctataatct gatttttatt      2880
     tattgtaaat attctcttct gtactagagc caacaccttt atatttaata actatattca      2940
     taacttggca aattatactc tagcttataa tacattttct tttaatgacc tacccattaa      3000
     aaatttaaaa tacattcttt gtggtggcag ttctttcagg tttgacagca atcagtgact      3060
     ttagtccttt aaaagcaaat gttagcagtt gcgactccat cactttctgt cccactcaaa      3120
     tgcacaaaat ccactttaga gaagtggctt actgtcactt gagatgaaat tcaacactta      3180
     atgtctatga gatcattatt agtttattaa tttagagccc taaaggagtt actttttcta      3240
     atatttagtg tgactttgtc ttctacattg cttgtaagca ataaaactgt atgaaacaaa      3300
     ttcaccctgc ttttgtattt gaattgtccc ccaccccaac tttttgtttt ctgctttatt      3360
     tctttactct aacaagtgga aaaagtcact ggatactcct ttttctgtgt taaaggtatt      3420
     ttctacacaa taaacattca agcctttg                                         3448
//

If you have problems or comments...

PBIL Back to PBIL home page