(data stored in ACNUC22857 zone)

EMBL: AK034140

ID   AK034140; SV 1; linear; mRNA; HTC; MUS; 4253 BP.
XX
AC   AK034140;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male diencephalon cDNA, RIKEN full-length enriched
DE   library, clone:9330159F11 product:adaptor protein complex AP-1, beta 1
DE   subunit, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4253
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 36a0529906b5bafd5a54ed9cd5024d9e.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9330159F11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4253
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9330159F11"
FT                   /tissue_type="diencephalon"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        455..3316
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adaptor protein complex AP-1, beta 1 subunit
FT                   (MGD|MGI:1096368 GB|NM_007454, evidence: BLASTN, 99%,
FT                   match=2027)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CC13"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="MGI:MGI:1096368"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CC13"
FT                   /protein_id="BAC28603.1"
FT                   /translation="MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGK
FT                   DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLD
FT                   TLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFI
FT                   LDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLL
FT                   KKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHK
FT                   PPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLLNL
FT                   DLGPPVSGPPLAASSVQMGAVDLLGGGLDSLMGDESEGIGDSNFGAPSASVAAAPAPAR
FT                   LGAPISSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGSISMDL
FT                   QLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEP
FT                   LNNLQVAVKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCP
FT                   LNTEAASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTDLEL
FT                   SLKCRAPEVSQHVYQAYETILKN"
FT   regulatory      4232..4237
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4253
FT                   /note="putative"
XX
SQ   Sequence 4253 BP; 964 A; 1190 C; 1181 G; 918 T; 0 other;
     gggcgcggcc ggcttgctgc tgccgcagcg ccgccgcctc gccctccagg ctgcggttgt        60
     gcgcctcgag ctgcctcacc ttgtcgatgt agcccgcgaa gcggtcgttc agagcctgca       120
     gctgctcctt ctcgctgcgc gccgccaccg ccgccaccac gcagccctct gggccgttgc       180
     ttagggtgtc tagcgagtcg gtgctcgagg cggcgccgcg gaagcggctg ggtgaggcgg       240
     acacggagct cacggacgtc cgcgcccacg agtggaagcc gctggaggag ccggccgcgg       300
     aggcgcgtgc cgcccggggc ctgccttgcg gctcagcgag tagtgcaggc tgccgcctcc       360
     gtgcagcggc gcgaacgggg cgcccagcag cgcatcggcg ctgccgaagc tcatcatggc       420
     cggagcagag tctggccaca gataaaggac caaaatgact gactcaaaat acttcaccac       480
     aaccaagaaa ggggagatct ttgagctgaa ggcagagctt aacagtgaca agaaggagaa       540
     gaagaaggag gcagtgaaga aagtgattgc atcaatgact gtgggcaaag atgtcagtgc       600
     tctcttccct gatgtggtga actgcatgca gacagacaac ctggagctaa agaagctggt       660
     gtacctgtac ttgatgaact atgccaagag tcagcctgac atggccatta tggctgtcaa       720
     cacctttgtg aaggactgtg aggaccccaa tcctctcatc cgggccctgg ctgtgaggac       780
     tatgggctgc atccgagttg acaagattac agagtacttg tgtgaaccac tccggaagtg       840
     cctgaaggat gaagacccat atgtgcgcaa gacagcggct gtgtgtgtgg ccaagctcca       900
     tgacatcaat gcccagctgg tagaagacca gggcttcctg gacacgctta aagacctcat       960
     ctcagactct aaccccatgg tggtagcgaa tgcagtggct gccctgtcag agatcgctga      1020
     gtctcacccc agtagcaacc tgcttgactt gaacccacag tctatcaaca agctgctgac      1080
     agcccttaat gagtgcactg aatggggcca gatcttcatt ctggactgtc tggccaacta      1140
     catgcccaag gatgaccgtg aggcccagag catctgtgag cgggtcactc ctagactctc      1200
     ccatgccaac tctgctgtgg tgctgtctgc ggtgaaggtg ctgatgaagt tcatggagat      1260
     gctgtccaag gacctggact actatgccac actgctcaag aagctggccc cacccctggt      1320
     cacactgctg tccgcagagc cagagctgca gtatgtggcc ctgcgcaaca tcaatctcat      1380
     tgtacagaaa aggccagaga tcttgaagca tgaaatgaag gttttctttg tgaagtacaa      1440
     tgaccccatc tacgtgaagc tggagaaact ggacattatg atccgcctgg cctcccaggc      1500
     caacattgcc caggtattgg cagaactcaa agagtatgct acagaagtag acgtggattt      1560
     cgtacggaag gcagtgcgtg ccattggccg ctgtgccatc aaggtggagc aatctgcaga      1620
     gcgctgtgtg agcacattgc ttgatctcat ccagaccaag gtcaactatg tggttcagga      1680
     agccattgtg gtcattaagg acatcttccg caagtacccc aacaagtatg agagtgtgat      1740
     agctacactg tgtgagaatc tggactctct ggatgagcct gaggcccgag ccgctatgat      1800
     ctggatagtg ggcgagtatg ccgagcggat tgacaatgca gacgagctgc tcgagagctt      1860
     cctggaaggt ttccatgatg agagcactca ggtccagcta cagctactga cagccattgt      1920
     gaaactcttc ctgaagaagc caacagagac tcaggagctg gtgcagcagg tcctcagttt      1980
     ggccactcag gactcagaca atccagacct tcgggaccgt ggctacatct actggcgctt      2040
     gctctccacg gaccctgtag ctgctaaaga ggtggtactg gctgagaagc ccctcatctc      2100
     agaggagaca gaccttattg agcctacact tctggatgaa ctcatctgct acattggcac      2160
     gctggcctct gtctaccaca agcctcccaa cgcctttgtg gagggtggcc ggggagtggt      2220
     acataagagc ctgccacccc gcactgcctc gagtgagagc acagagagcc ctgagacagc      2280
     tcctgctgga gcacctgctg gtgatcagcc tgatgtcatt cctgcccagg gtgacctgtt      2340
     aggtgacctc ctcaacctgg accttgggcc cccagtgagt ggcccaccct tagctgcctc      2400
     ctccgtgcaa atgggagctg tggatcttct tggtggtggc ctcgacagcc tgatggggga      2460
     tgagtctgaa gggattggag atagcaactt tggggcacct tcagcatcag tggccgcagc      2520
     accagcacca gccagacttg gagcacccat cagcagtggc ttaagtgacc tctttgacct      2580
     gaccagtggt gtgggcaccc tttcaggatc ctatgtagct cccaaagcag tctggctccc      2640
     tgccatgaag gccaagggac tggagatctc tggcaccttc acccggcagg ctggctccat      2700
     ctctatggac ctgcagctga ctaacaaggc cctgcaggtc atgacagatt ttgctatcca      2760
     gttcaatcgt aacagctttg gcttggcccc tgctgcacct ctccaggtgc acgtaccact      2820
     cagccccaac cagaccgtgg agatctccct gcctcttaac acagtgggct cagtcttgaa      2880
     gatggagcct ctaaacaatc ttcaggtggc tgtgaagaac aacattgacg tcttctactt      2940
     cagcactttg tacccactgc atgtcctctt cgtggaggat gggaagatgg accggcagat      3000
     gttcctggcc acatggaagg acattgccaa cgagaacgaa gcccagttcc agatcagaga      3060
     ctgcccgctt aacacagagg ctgcgagcaa caagctacag agcagtaaca ttttcactgt      3120
     cgccaagagg aacgtggagg gccaggatat gctctaccaa tctctgaagt tgaccaatgg      3180
     catctgggtg ctggcggagc tgcggatcca gccaggcaac cccagcttca cggacttgga      3240
     gctgtccctg aagtgtcgag caccggaggt gtcccagcat gtataccagg cctacgagac      3300
     tatcctcaag aactgaagcc ctgtcgcatc caccccagcc ttctgccagc ccagtcatgg      3360
     aaccctgcag gtggcagtac ctcctccttt ctttgaggaa aggccaggtg ggctcctgaa      3420
     ccacccagga ggctcccctg atcctaactg agggtctgga gcagggccat gtctcctccc      3480
     agagtgaaat ctcagtgcat ctccagtggc tgcttttttc tattgctgtt gatgtgggat      3540
     caaaggaaat ggagccagca cagcatcaga agctggacag agggccacag ggtgctcttc      3600
     cttctcttct cctgggtgtg aacatggacc ccacccccac ccccagggtc ctagcccata      3660
     atccctgccc agtctcctca gtgagcctgt cctgggtgga gtcctctggg tgccaatatt      3720
     actgcttggg actccaaggg ctggaagtgg tgatgggcag atgtgagccc agaggagcag      3780
     cctgggccag caccatctgc cccatgtaac cccagtcggt gctctgtggc cacctgcagg      3840
     tcccagagcc cagctgggat tatgttctct gtgccccgga agatggtcac tgcctacaaa      3900
     acattcctgg tgtcccctct gtgagtccag ggctcttaga acagaaatag ggtaagaggt      3960
     ggagcaaggg gcagtggaca tgcttctggt gtgaggtcct gtgggttctc cagcagccgc      4020
     tggctcccct ggctcccagt ctgtgtgtgt gacagctatc ctgtcactgc tgtttgataa      4080
     taaagagatt ctgctttcgg caatcatgca catttcttcc ctctacaaac tgcttctggt      4140
     aactggggat gtctgatcct gcagtaatta tatctaatac atataatgaa atatatattg      4200
     tatatttacc cttttttcaa ataagaaagt gaataaaaac gatgacatca agt             4253
//

If you have problems or comments...

PBIL Back to PBIL home page