(data stored in ACNUC9306 zone)

EMBL: AK035271

ID   AK035271; SV 1; linear; mRNA; HTC; MUS; 2525 BP.
XX
AC   AK035271;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male urinary bladder cDNA, RIKEN full-length enriched
DE   library, clone:9530007N19 product:villin 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2525
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 558831d36e657d1f93458ff7ee9193da.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9530007N19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2525
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9530007N19"
FT                   /tissue_type="urinary bladder"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..1266
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="villin 2 (MGD|MGI:98931 GB|NM_009510, evidence:
FT                   BLASTN, 99%, match=2105)"
FT                   /db_xref="GOA:Q8CBU4"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBU4"
FT                   /protein_id="BAC29009.1"
FT                   /translation="DQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKN
FT                   KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVF
FT                   YAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKK
FT                   RRETVEREKEQMLREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAE
FT                   RLEADRMAALRAKEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQ
FT                   HRAKEAQDDLVKTKEELHLVMTAPPLPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSS
FT                   EGILDDRNEEKRITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDK
FT                   YKTLRQIRQGNTKQRIDEFEAM"
FT   regulatory      2504..2509
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2525
FT                   /note="putative"
XX
SQ   Sequence 2525 BP; 692 A; 588 C; 710 G; 535 T; 0 other;
     gaccagtggg aggaccggat ccaggtgtgg cacgcggaac accgagggat gctcaaggac        60
     agtgctatgc tagaatacct gaagattgcc caggacctgg aaatgtatgg gatcaactat       120
     ttcgagatca aaaacaagaa aggaacagac ctttggcttg gagtcgatgc ccttggactt       180
     aacatttatg agaaagatga caagttgacc ccaaagatcg gcttcccttg gagtgagatc       240
     aggaacatct ctttcaacga caagaagttt gtcattaagc ccatcgacaa gaaggcacct       300
     gactttgtgt tctacgcccc gcgcctgaga attaacaagc ggatcctgca gctctgcatg       360
     gggaaccatg agctgtacat gcgccgcagg aagcccgaca ccatcgaggt gcagcagatg       420
     aaggcccagg ctcgggagga gaagcaccag aagcagctag agcgacagca gttggaaacc       480
     gagaagaaga ggcgagagac ggtggagaga gaaaaggagc agatgctccg ggagaaggag       540
     gagctgatgc ttcggctgca ggactacgag cagaagacca agagggcgga gaaagagctc       600
     tccgagcaga ttgagaaggc cctccaactg gaggaagaga ggaggcgagc ccaggaggag       660
     gctgaacgtc tggaggccga ccgcatggcc gccctgcggg ccaaggaaga actcgagaga       720
     caggcgcagg atcagataaa gagccaggag cagctggctg cagagctggc agagtacacg       780
     gccaagatcg cactgctgga ggaggcgcgg aggcgcaagg aggacgaggt agaagagtgg       840
     cagcaccggg ctaaagaagc ccaggacgac ctggtgaaga ccaaagagga gctgcacctg       900
     gtgatgacgg ccccaccgct cccaccgccc ccagtgtatg agcctgtgaa ttaccacgtg       960
     caggagggac tgcaggacga gggagcagag cctatgggct acagtgccga gctctccagt      1020
     gagggcatcc tggatgaccg caacgaggag aagcggatca cagaggcaga gaagaatgag      1080
     cgcgtgcagc ggcagctgct gaccctgagc aatgagttgt cccaggcccg ggatgagaac      1140
     aagaggaccc acaatgacat catccacaac gagaacatgc ggcaaggcag ggacaagtat      1200
     aagacgctgc ggcaaatcag gcagggcaac accaagcaac gcattgacga gttcgaggcc      1260
     atgtagaggc caggctggga ccaagggcag agggcacctc actgcaggca ggtgtcacac      1320
     ttggctcttt agttctctta agtttagaca cccccttgct gtgttccagt cccttaaaga      1380
     gcagttacgg ggcctgcatt ctgccccgag acccagtggg ctcctccttg gttccttcta      1440
     attgtatcac atagtgccaa acaggtcaga tttaatgaca gttaccgaat cacttcctgt      1500
     ttggagcagg gattcggagg gctggccctc atgaagcaag attcattgtc actgggacag      1560
     cactgtggct cacgggtgcc atacttttct ctagttttac aatgagctca aatcgatttt      1620
     gttcttgatt tttatgaagg atccatctct gtgtattgag gggtaaaaat gattttgaaa      1680
     tttgagtcta aagcatgccc ccacagagtc tccttcctcc agaccgctgg cagagtctcc      1740
     aggggtcctt cagagtgtac ggtacaggac tctccgatac aaaattctca tgcttatctg      1800
     ttagcataca ttgttggact tatatatcta atgatctgct atagaggata gtatttatat      1860
     ataagcgata atatgggttt gtaacattag ttttaaaaaa gggaaagttt tgttctgtat      1920
     attttgttac cttttacaga ataaaagaat tcaacattaa gaaccatgta accgagacac      1980
     ttgatctgac acaggggcag tcgggaaacc gatgactgca gtaatcacca ctgtacaaaa      2040
     atgttagtgg gttttgtgca cgtaaaatgc acacttccat ttcctgtcag tttcttattt      2100
     gaaaaaaaaa aaatacacac cgagagcatc cagactccag ccctgaaggg acgccggcct      2160
     ctttattgtg agcaacttgt tcccgttttc agtttgtctt ccttcctttc gcggactagc      2220
     ctccttggtt gtgatgtctg tcctgtgcgg gtgactccgc accagattta cacacaataa      2280
     aagctctcca aggccttgtg tctgattgca tggggggggt tggggtggga gtggggggtc      2340
     tctcagactt gtcctcggga ttcaggaagc atgctaatca gagaggggtc ttccccagct      2400
     cccctgcact gggaggtttg ccacccgaga ggagcacaaa gcattcaacc tacttctatt      2460
     ttcctctgaa acaacatata acaaagctaa aaacgtggtt gttaataaat gctgggagtt      2520
     acagg                                                                  2525
//

If you have problems or comments...

PBIL Back to PBIL home page