(data stored in ACNUC15468 zone)

EMBL: AK036735

ID   AK036735; SV 1; linear; mRNA; HTC; MUS; 3547 BP.
XX
AC   AK036735;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male bone cDNA, RIKEN full-length enriched library,
DE   clone:9830168O13 product:CHLORIDE CHANNEL PROTEIN, SKELETAL MUSCLE
DE   (CHLORIDE CHANNEL PROTEIN 1) (CLC-1), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3547
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b339edd25eac3b4f41ee4cb3b3e3a7a9.
DR   Ensembl-Gn; ENSMUSG00000029862; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030646; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030544; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030342; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030418; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030452; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029458; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029822; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031894; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0077278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0077180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077218; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077686; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077418; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0076799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0076950; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0076845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0076995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077929; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076842; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075966; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9830168O13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3547
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9830168O13"
FT                   /tissue_type="bone"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        85..3069
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CHLORIDE CHANNEL PROTEIN, SKELETAL MUSCLE (CHLORIDE
FT                   CHANNEL PROTEIN 1) (CLC-1) (SWISSPROT|Q64347, evidence:
FT                   FASTY, 98.1%ID, 100%length, match=2982)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q64347"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002243"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:88417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64347"
FT                   /protein_id="BAC29557.1"
FT                   /translation="MERSQSQRHGGEQSWWGSAPQYQYMPFEHCTSYGLPSENGGLQHR
FT                   PRKDMGPRHNAHPTQIYGHQKEQYSYKAQDGGMPKKMGSSSTMDSLDEDHYSKCQDCVH
FT                   RLGRVLRRKLGEDWIFLVLLGLLMALVSWCMDYVSAKSLQAYKWTYAQMKPSLPLQYLA
FT                   WVTFPLILILFSALFCQLISPQAVGSGIPEMKTILRGVVLKEYLTLKAFVAKVVALTAG
FT                   LGSGIPVGKEGPFVHIASICAAVLSKFMSMFSGVYEQPYYYTDILTVGCAVGVGCCFGT
FT                   PLGGVLFSIEVTSTYFAVRNYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMD
FT                   FPFDLKELPAFAVIGICCGFLGAVFVYLHRQVMLGVRKHKCLSQFLAKHRLLYPGIVTF
FT                   VIASLTFPPGMGQFMAGELMPREAISTLFDNNTWVKHIGDPQSLGQSAVWLHPQVNVII
FT                   IILLFFVMKFWMSIVATTMPIPCGGFMPVFVLGAAFGRLVGEIMAMLFPEGILFDDIIY
FT                   KILPGGYAVIGAAALTGAVSHTVSTAVICFELTGQIAHILPMMVAVILANMVAQSLQPS
FT                   LYDSIIQVKKLPYLPDLGWNQLSKFTIFVEDIMVRDVKFVSASCTYGELRNLLQATTVK
FT                   TLPLVDSKDSMILLGSVERSELQSLLQRHLCAERRLKAAQDMARKLSELPYNGKAQLAG
FT                   DWHPGGRPESFAFVDEDEDEDLSRKMELPLTPAPPPPSPPPPPSQFPIAPSNPEEPNGP
FT                   LPSHKQPPEASDSADQRSSTFQRLLHCLLGKAHSKKKKITQDSTDLVDNMSPEEIEAWE
FT                   REQLSQPVCFDCCCIDQSPFQLVEQTTLHKTHTLFSLLGLHLAYVTSMGKLRGVLALEE
FT                   LQKAIEGHTKSGVQLRPPLASFRNTTSIRKTPGGPPPPAEGWNVPEDGDGAPGREVMVP
FT                   TMPETPVPPPSPEAPSCLAPARAEGELEELEMVGSLEPEEELADILHGPSLRSTDEEDE
FT                   DELIL"
XX
SQ   Sequence 3547 BP; 803 A; 958 C; 902 G; 884 T; 0 other;
     gaaaaagcag aggcttaagg agctacttgg gggagactag gagcaagcag gccaaggcct        60
     ggctggggct tggggggaga acacatggag cggtcccagt cccagcggca tggaggggaa       120
     cagagctggt ggggcagtgc cccccagtac cagtacatgc cctttgaaca ttgtaccagc       180
     tacggactgc cctcagagaa tgggggcctt cagcaccggc cccgaaagga catgggtccc       240
     aggcacaatg cccacccaac acagatatat ggccatcaaa aagaacaata ttcatataag       300
     gcacaggacg ggggaatgcc caagaagatg ggctccagtt ctaccatgga cagcttggat       360
     gaggaccact attctaaatg tcaagactgt gtccatcgcc tgggacgtgt gctgagaagg       420
     aagctggggg aagattggat ctttcttgtg ctcctgggcc tcctgatggc tctagtcagc       480
     tggtgcatgg actatgttag tgccaagagc cttcaggcct acaagtggac ctatgcccag       540
     atgaagccta gccttcctct gcagtacctg gcctgggtca ccttcccact tatcctgatc       600
     ctcttcagcg ccctcttttg ccaactcatc tctccccagg ctgtgggctc tggaatccct       660
     gagatgaaaa caattcttcg tggtgttgtc ttgaaggaat acctcacact caaggccttt       720
     gtagccaagg tggtagcttt gacagctgga ctgggcagtg gcatccctgt ggggaaagag       780
     ggtccctttg ttcacatcgc cagcatctgt gctgctgtcc tcagcaagtt tatgtccatg       840
     ttctctggtg tctatgagca gccatactat tacactgaca tcctgacagt gggctgtgcc       900
     gtgggggtcg gttgctgttt tggaacacca cttggaggag tgctatttag catcgaggtc       960
     acctctacct actttgctgt tcggaattac tggcgaggat tctttgcagc cacattcagt      1020
     gcctttgtgt tccgtgtcct ggccgtttgg aacaaggatg ctgtcaccat cactgctctg      1080
     ttcagaacga atttccgaat ggatttcccc tttgacctga aggaactccc agcttttgct      1140
     gtcattggga tttgctgcgg gttcttggga gctgttttcg tttatctgca tcgccaagtc      1200
     atgctcggtg tccgaaagca caagtgtctc agccaatttc ttgctaagca ccgcctgcta      1260
     tatcctggaa ttgttacctt tgtcatcgcc tcgctcacat ttccaccagg aatgggtcaa      1320
     ttcatggctg gagagctgat gccccgtgaa gctatcagta ccctctttga caacaacaca      1380
     tgggtaaagc acataggtga cccccaaagc ttgggccagt cagctgtgtg gcttcacccc      1440
     caggtcaacg tgatcatcat catccttctc ttcttcgtta tgaagttttg gatgtccatt      1500
     gtagccacca ctatgcccat accctgtgga ggcttcatgc ctgtttttgt gctaggagct      1560
     gcatttggaa ggctggtagg agagatcatg gccatgctat tccctgaggg tatcttattt      1620
     gatgatatca tctataagat cttacctggg ggctatgcag taattggagc agcagctttg      1680
     acaggggctg tctcccacac agtctccaca gccgtcattt gcttcgaatt aaccggtcag      1740
     attgctcaca tcctgcccat gatggtggct gttatcttgg ccaacatggt ggctcagagt      1800
     ctgcagccct ccctctatga cagcatcatc caggtcaaga agcttcccta tctgccagac      1860
     cttggttgga accagctcag caaatttaca atttttgttg aggacatcat ggtacgtgat      1920
     gtgaagttcg tttcagcttc ttgtacatat ggggaactga gaaacctact ccaggccacc      1980
     acagtcaaga ctttaccatt ggttgactcc aaagattcaa tgatcctgct gggctctgtg      2040
     gaacgctcag aactgcagtc cctcctgcag cgccacctgt gtgcagagcg aaggttgaag      2100
     gctgcccagg acatggctcg aaagttatca gagctgcctt ataatggcaa ggctcagctg      2160
     gctggggact ggcatcctgg tggtcgacct gagtcctttg ccttcgtaga tgaagatgaa      2220
     gatgaggacc tctccaggaa gatggagctt ccactgactc cagctcctcc ccctccttcc      2280
     cctcctcctc caccttccca gtttcctatt gctccatcaa accctgaaga acctaatggg      2340
     ccactgccca gccataaaca gccacctgaa gcctcagact ctgcagatca aagatcatcc      2400
     accttccaac gcctgctgca ctgcttgcta ggaaaagctc actccaaaaa gaagaaaata      2460
     acacaggatt caacagattt agtggataac atgtcacctg aagagattga ggcctgggag      2520
     cgggagcagc tgagccagcc tgtgtgcttt gattgctgct gcatcgacca gtctcccttc      2580
     cagctggtgg agcagacaac cctgcacaag actcatacac tcttctcact tcttggcctc      2640
     catcttgcct atgtgaccag catggggaag ctcagaggtg tcttggcact agaagagcta      2700
     cagaaagcta ttgagggcca caccaaatct ggggtgcagc ttcgccctcc acttgccagc      2760
     ttccggaata caacttcaat ccggaagact cctggggggc caccccctcc tgcagagggc      2820
     tggaatgtac ctgaggatgg agatggggct cctggaagag aagtcatggt tcctaccatg      2880
     ccagagactc ctgtcccacc accatctcca gaggcccctt cctgcctggc cccagccaga      2940
     gcggagggtg agctggagga actggagatg gtggggagcc tagagcctga ggaggagctg      3000
     gctgacatct tgcatggccc cagtctgcgg tccactgatg aggaagatga ggacgagctg      3060
     atcctgtgaa caaccccctc tatgccttct tcttaaaaac cacagggccc atgtcagaga      3120
     gtggacgtgt atgtgatatg gagaggcctc cacttcatct tcttcctacc accactgtga      3180
     aaggtgatgg tgataatctt aaggagaact tgatcttggg cagggaagaa tttgggtcca      3240
     tcagacctcc ccccgccacc ccccatttcc atgcttaaag gactcttgtg ttttcctgct      3300
     gtgcaggttc agtccctatc actctaaagc cccacagttc ccagtgttca gtcaccatcc      3360
     tggccctgcc tgtttatatt cagtttccat acggagtagg tgagtggagg tccatattgg      3420
     atgaatctgc aagtgtcaca ttggaaggga atgtgggacc acaatattgc catgtggatt      3480
     gactacccta aaatgtgtcc ccaagtctgc cagtcctgtg tgctctccaa aatctgtctt      3540
     agacccc                                                                3547
//

If you have problems or comments...

PBIL Back to PBIL home page