(data stored in ACNUC8465 zone)

EMBL: AK036928

ID   AK036928; SV 1; linear; mRNA; HTC; MUS; 3699 BP.
XX
AC   AK036928;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult female vagina cDNA, RIKEN full-length enriched library,
DE   clone:9930026F05 product:mitogen activated protein kinase kinase 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3699
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c99f7453193f10a23022a12de64f0ace.
DR   Ensembl-Gn; ENSMUSG00000033352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018415; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018417; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018313; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018327; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018910; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017839; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000046963; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029659; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029679; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029479; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029178; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029395; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029510; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029496; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030213; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028884; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028967; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9930026F05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3699
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9930026F05"
FT                   /tissue_type="vagina"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        58..1251
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 4
FT                   (MGD|MGI:1346869 GB|U18310, evidence: BLASTN, 99%,
FT                   match=2244)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q543X6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346869"
FT                   /db_xref="UniProtKB/TrEMBL:Q543X6"
FT                   /protein_id="BAC29642.1"
FT                   /translation="MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLN
FT                   FANPPVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLG
FT                   EIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFY
FT                   GALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLK
FT                   IIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQG
FT                   YDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFIN
FT                   FVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 3699 BP; 1014 A; 839 C; 829 G; 1017 T; 0 other;
     cggggagctt gctgcattgc agccgccgcg gcgccgctcg gctcttcact tccaacaatg        60
     gcggctccga gcccgagcgg cggcggcggc tccgggggcg gtggcggcac cccggggccc       120
     atcggacctc cagcttctgg ccacccggcg gtcagcagca tgcagggtaa gcgcaaagca       180
     ctgaagttga attttgcaaa tccacctgtc aaatcgacag cacggtttac tctgaatcct       240
     aatactacag gagtccagaa cccacacata gagagactga gaacacacag cattgagtca       300
     tcaggaaaac tgaagatctc ccctgaacaa cactgggatt tcactgcaga ggacttgaaa       360
     gaccttggag aaattggacg aggagcttat ggttctgtca acaaaatggt ccacaaacca       420
     agtgggcaga taatggcagt taaaagaatt cggtcaactg tggatgaaaa agaacaaaaa       480
     caacttctca tggatttgga tgtagtaatg cggagtagtg attgcccata cattgttcag       540
     ttctatggtg cactcttcag agagggcgac tgttggatct gtatggagct catgtctacc       600
     tcgttcgata agttttacaa atatgtatat agtgtgttag atgacgttat tccggaagag       660
     atcttaggca aaatcacttt agcaactgtg aaagcactaa accacttaaa agaaaacttg       720
     aaaattattc acagagacat caaaccttcc aatattcttc tggacagaag tggaaatata       780
     aagctctgtg atttcggcat cagtggacag cttgtggact ctattgccaa gacaagagat       840
     gctgggtgta ggccgtatat ggcacctgaa agaatagacc caagtgcatc aagacaaggg       900
     tatgatgtcc gctctgatgt ctggagtttg gggatcacat tgtacgagtt ggccacaggc       960
     cgatttcctt atccaaagtg gaatagtgta tttgatcagc taacacaagt ggtgaaagga      1020
     gaccctccgc agctgagtaa ttctgaagaa agggagttct cccccagttt catcaacttt      1080
     gtcaacttgt gccttacgaa ggatgaatcc aaaaggccaa agtataaaga gcttctgaaa      1140
     catcccttta ttttgatgta tgaagaacgt actgtagagg tcgcatgcta tgtttgtaaa      1200
     atcctggatc agatgccagc cactcccagc tcgcccatgt atgtcgactg ataccgctgc      1260
     tacatcagac tctagaaaaa agggctgagg ggaagcaaga cgtaaagagt tttcatcctg      1320
     tatcacagtg tttttattgc tcgcccagac accatgtgca ataagactgg tgttcgtttc      1380
     catcatgtct gtatacttct gtcatctaga ctgtgcatcc ctgtaatacc tgactgatca      1440
     cagtgttagt gctggtcaga gagacctcat cctgctcttt tgtgatgaac atattcatga      1500
     cgcgtggaag tcagtacgat caagttgttg actgtgatta gatcacacct taattcattt      1560
     ctagactcaa aacctggaga cgcagctact ggaatggtgt tttgtgagac ttccaaggct      1620
     ggaaagacac agtcatggat gtactgtctg agcatagaga acccgggctt gagtgagaag      1680
     agcttgcaca gccagtgaga cacattgcct tctgcagctg ggagacagag gaaggattcc      1740
     ctttcttcac caagtgcaat agatttcctc atctgatagg ctgttgcttt accgtcacac      1800
     gcgatgtgct cagccaaatt ccctactcaa aatatcatgt taaattagaa tttatcttta      1860
     ccaaaaacca tgttgctttc agagaggtca acattaaaat actgagacag gacagaatgt      1920
     gttctttgtc cttttccagc cctgctcttc tctgggaaga tacaggagtc tgccacctgt      1980
     catagaaggg tgctgccaac ttgatgctct acctgccacc aaccaccagg actgaaggaa      2040
     ggaaacagta ctgagggcaa agtttacaga tgtttttgat tctggcattt tgtccagaac      2100
     agcttgtagc agctatagat tcccccttgg ccccaagcct gggacttgag ccatcgtaac      2160
     tcactaacag ggagaattag ctagtagcaa tgtgccttga tgaagatttc ctgcaggcag      2220
     caaaacacca aatcacaacg ctttgcttct cgacatcatg ggccaggtcc tcagtttcta      2280
     actctttccc ttccccacag ttcgttgtcg ccatgcggct tttgctcagt ctagtattct      2340
     gccttgtttt tcacattggg aaccctaaca ttaccaggga tgctacttac cacaatttgt      2400
     aaccctgaat ctctcctgtg ctctggtgtt cagaaagctg agacagctgg gcccagttga      2460
     tgttgtacgt gagaaagagg cagtctgtcg gagaggcata cttgagcagg ataaagatcc      2520
     taaatggcag cctttcagat aggcatgtct gacacctgct gaggcctcta ccagttcact      2580
     ctctcccttg gaagtggaat tctacccacc taaacccccc aaaaaagaca aaacgaaaag      2640
     aagccacttc atcttatgtg ccgctgcttg tcttcagccc attagccagg tactgagcgt      2700
     caggctctgc atagcagtta agcagcactg gtagtggtct gccgtgcagg ggatgcctgc      2760
     tatgcaggtg atgccctccc aggatctatt cctggtgggc actgctgtgt ctcccccaga      2820
     gtggcactca aagtactatc aaacaataaa aggaaaatgg tgctgtttga agttacatcc      2880
     cttctctttg gaggatttaa aaatgatcta tcttttggtc cacttgccta attttcccat      2940
     tttccacccc tggcccccta cccttagatt ctctgtgttc cacaaggaga catcatgaga      3000
     tgtcttcctt aagctgcagc caagccattg tcctccgttg ttcccaggac tcaagaggaa      3060
     tttgtttctc tgctgtcagc ttcctgtctg gctcagtata gcctcactct gccgttatgc      3120
     aaatggagat caaagtaatt ctgactgtcc aggagctatc tcactttctg ctgtgtgggc      3180
     ggccacataa aaaggcaatt ttagtgtatt aatcatagat tattataaac tataaactta      3240
     agggcaagga atttattaca atgtatcttt attaaaacaa aagggtgtat agtgttcaca      3300
     aactgtgaaa atagtgtaag aactgtacat tgtgagctct ggttattttt ctcttgtacc      3360
     atatgaaagt atataaaaat tatcaaaaag ctgatgtgca gggatattgc cttatttgtc      3420
     tgtaaaaatg tagctcagta acataactgc ttcttggagc tttggaatat tttatcctgt      3480
     attcttgttt gaatccttcc tctatttaag acatagccat ggagcccaca tgtttatgga      3540
     atagtctacc ctttgcctgc aggtcagttg taataaatct aggttgtgat gatggtctag      3600
     taatctgatt ttctgcagtc ataccccgag aaagaaattc aagaaaaaat gacattaaat      3660
     catctgtgca tttcatatac aggagagtta tctccttcc                             3699
//

If you have problems or comments...

PBIL Back to PBIL home page