(data stored in ACNUC18858 zone)

EMBL: AK039414

ID   AK039414; SV 1; linear; mRNA; HTC; MUS; 2223 BP.
XX
AC   AK039414;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 9)
XX
DE   Mus musculus adult male spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:A330041C17 product:weakly similar to DJ1153D9.2 (Novel
DE   protein similar to beta 1,6-N- acetylglucosaminyltransferase) (Fragment)
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2223
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6e865113e292daca921b0361e8947bff.
DR   Ensembl-Gn; ENSMUSG00000074569; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026913; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026922; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026664; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027369; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026122; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026641; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026880; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026764; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025859; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026195; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000099060; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059534; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059567; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059511; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059967; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059166; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059269; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059247; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059379; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059234; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060153; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059050; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058471; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A330041C17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2223
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A330041C17"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        170..1471
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to DJ1153D9.2 (Novel protein similar
FT                   to beta 1,6-N- acetylglucosaminyltransferase) (Fragment)
FT                   [Homo sapiens] (UniProt|Q9HCV8, evidence: FASTY, 59.8%ID,
FT                   100%length, match=989)"
FT                   /db_xref="GOA:Q3V3K7"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="MGI:MGI:3606143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V3K7"
FT                   /protein_id="BAE20545.1"
FT                   /translation="MSQLRTTKAGLVACGMICAFIFLYLRNPGPEEAEAEAEAEPTNPA
FT                   VVECGFYPDELCSALFDGKKAAPQIAQFCKPPQNSEVPARLRTPGNCSRLARGLHFITR
FT                   PLSAEEGNFSLAYVIHAPRELVMFVRLLRAIYAPQNVYCIHSDENAPKKFKSAMQTFVD
FT                   CFGNIFLSSKTQKVAHDNLRRLQAEIDCMRDLVHSPFQWHYVMNLCGQEFPIKTNKEII
FT                   YDIRTRWKGKNITPGVTPPANSKPKTGQGPPKPSPDENSYTAPNTIFKQSPPHNLTISS
FT                   GSAHYALTRKFVEFVLTDPRAKDMLQWSKDIQSPEKHYWVTLNRLKDAPGATPDAGWEG
FT                   HIRATKWRTEAGDGRKGCTDHDAQDTCVYGLGDLPGLIRLPAFFATLEPSSDPLVGVCL
FT                   ERRHRLRALQQAEVPPEPHWQFPQQSHFNSQPHH"
XX
SQ   Sequence 2223 BP; 585 A; 603 C; 563 G; 472 T; 0 other;
     gaactctaag aagcaggagc cgcagtgagg gaagcattcg tccgtcagag gagaggtggc        60
     taggccagca cctgcccagg ttcctgccag gcaacgggac ctgcacctgg agaactaaaa       120
     ggaaaacctt tcaagctatg gtggcgacaa cacactgaga gctcaaagca tgagccagct       180
     ccggaccaca aaggctgggc tggtggcatg tggcatgatt tgcgccttca tctttcttta       240
     cttgagaaac ccaggtcctg aggaggctga ggctgaggct gaggctgagc ccaccaaccc       300
     agctgtggtg gaatgtggct tctatccaga tgaactgtgc tcagctttat ttgacgggaa       360
     aaaggcagcc ccccaaatcg ctcaattctg caaaccccct cagaactctg aagttcctgc       420
     tcgcttgcgc acacctggaa actgctccag gctggctcgg gggctgcact tcataaccag       480
     acccctgtct gcagaagagg ggaacttctc cttggcctat gttatacatg ctccgaggga       540
     gctggtcatg tttgtgcggc ttctcagagc gatttatgca cctcagaatg tctactgtat       600
     ccacagtgat gaaaatgccc caaagaagtt taagagtgcc atgcaaacct tcgtggactg       660
     ttttggaaac atctttcttt catcaaagac acagaaggtg gctcatgaca acctcaggag       720
     gctgcaggca gagattgact gcatgaggga cctggtccac tccccatttc aatggcacta       780
     tgtcatgaat ctctgtggac aggaattccc tatcaaaacc aacaaagaaa tcatctatga       840
     catcagaacc aggtggaagg gtaaaaacat cacgcctggg gtgaccccac ccgcaaactc       900
     caaacccaag acaggccaag gccctccaaa gcccagtccc gatgaaaaca gctacacagc       960
     tccaaataca attttcaaac aaagcccacc ccacaatcta acaatttcct ctggaagtgc      1020
     tcactatgca cttacgagga agtttgtaga gttcgtccta actgatcccc gtgcaaaaga      1080
     catgctgcag tggtccaaag acatccaaag cccggagaag cactactggg tgaccctgaa      1140
     ccgactgaaa gacgctccag gtgccacacc agatgctgga tgggaaggac acattcgggc      1200
     cacaaagtgg agaacagagg caggagatgg tcgcaagggg tgcacagacc acgatgccca      1260
     agacacttgt gtgtatggcc tgggagacct gcctgggctc atccggctgc cagctttctt      1320
     tgccacgctg gagccctcct cagacccgct ggtgggagta tgcctagaga ggcggcaccg      1380
     actcagagcc ctacagcagg ccgaggtccc tccagagcca cactggcagt ttccccagca      1440
     aagccacttc aacagtcaac ctcaccatta aggcacttgt cagcattgct ttttaaattc      1500
     ttggatgtga atgatttaaa aaatgatgca gagacatgtg ccaccagact tcaccactac      1560
     acaggcaggg agagaactat gaggaaaaca cccgaggctg tggctaggag cccaagccaa      1620
     cagctggagg cccagcgcat tatcagctgc cgaatctctc cacctgctca atccagctca      1680
     cgtgggacac accagcagcg ggtctggttc tgaaggccta gagagcctga gtaagaggcg      1740
     catatatagc aaagccccac ccacaggaag ccatgcttct ctggagctgt ccctatggac      1800
     taagagcagt acaactttgt tctagaaaat tccaggaaag catttagggg tagaatgaat      1860
     aatcccacag aggaagcaag cttcttaaga atgctgcctc aactctgtgt agtcttggcg      1920
     tgccatctgc tgttcttcct gccatgttgg gggccacaac tgcactgctc gtgccacttc      1980
     cacaggggct tctgcacaca agagcgtgac ttttacggag tgtttcgagt taggtatgtg      2040
     gcaagtggcc aacaccctgg tgtatgggct gaagacataa aaggccatga ccatcttggg      2100
     cctcaggtgc aggcccttcc ttcctatgtc cctgactgtt gctgctgctg ttctgggaaa      2160
     cttctataga tgctctttct ctagcaatgt ccttggtggc ataaagactg acatgttcaa      2220
     gtg                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page