(data stored in ACNUC8465 zone)

EMBL: AK044698

ID   AK044698; SV 1; linear; mRNA; HTC; MUS; 2608 BP.
XX
AC   AK044698;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult retina cDNA, RIKEN full-length enriched library,
DE   clone:A930034E04 product:mitogen activated protein kinase kinase 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2608
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6995478ca28cc265d1fd764b98af02b0.
DR   Ensembl-Gn; ENSMUSG00000033352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018415; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018417; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017786; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018313; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018385; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018327; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018910; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017839; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000046963; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029659; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029679; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029479; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029178; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029395; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029510; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029645; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029496; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030213; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028884; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028967; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A930034E04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2608
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A930034E04"
FT                   /tissue_type="retina"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        46..1239
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="mitogen activated protein kinase kinase 4
FT                   (MGD|MGI:1346869 GB|U18310, evidence: BLASTN, 99%,
FT                   match=2244)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q543X6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346869"
FT                   /db_xref="UniProtKB/TrEMBL:Q543X6"
FT                   /protein_id="BAC32038.1"
FT                   /translation="MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLN
FT                   FANPPVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLG
FT                   EIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFY
FT                   GALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLK
FT                   IIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQG
FT                   YDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFIN
FT                   FVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 2608 BP; 715 A; 610 C; 609 G; 674 T; 0 other;
     ggcattgcag ccgccgcggc gccgctcggc tcttcacttc caacaatggc ggctccgagc        60
     ccgagcggcg gcggcggctc cgggggcggt ggcggcaccc cggggcccat cggacctcca       120
     gcttctggcc acccggcggt cagcagcatg cagggtaagc gcaaagcact gaagttgaat       180
     tttgcaaatc cacctgtcaa atcgacagca cggtttaccc tgaatcctaa tactacagga       240
     gtccagaacc cacacataga gagactgaga acacacagca ttgagtcatc aggaaaactg       300
     aagatctccc ctgaacaaca ctgggatttc actgcagagg acttgaaaga ccttggagaa       360
     attggacgag gagcttatgg ttctgtcaac aaaatggtcc acaaaccaag tgggcagata       420
     atggcagtta aaagaattcg gtcaactgtg gatgaaaaag aacaaaaaca acttctcatg       480
     gatttggatg tagtaatgcg gagtagtgat tgcccataca ttgttcagtt ctatggtgca       540
     ctcttcagag agggcgactg ttggatctgt atggagctca tgtctacctc gttcgataag       600
     ttttacaaat atgtatatag tgtgttagat gacgttattc cggaagagat cttaggcaaa       660
     atcactttag caactgtgaa agcactaaac cacttaaaag aaaacttgaa aattattcac       720
     agagacatca aaccttccaa tattcttctg gacagaagtg gaaatataaa gctctgtgat       780
     ttcggcatca gtggacagct tgtggactct attgccaaga caagagatgc tgggtgtagg       840
     ccgtatatgg cacctgaaag aatagaccca agtgcatcaa gacaagggta tgatgtccgc       900
     tctgatgtct ggagtttggg gatcacattg tacgagttgg ccacaggccg atttccttat       960
     ccaaagtgga atagtgtatt tgatcagcta acacaagtgg tgaaaggaga ccctccgcag      1020
     ctgagtaatt ctgaagaaag ggagttctcc cccagtttca tcaactttgt caacttgtgc      1080
     cttacgaagg atgaatccaa aaggccaaag tataaagagc ttctgaaaca tccctttatt      1140
     ttgatgtatg aagaacgtac tgtagaggtc gcatgctatg tttgtaaaat cctggatcag      1200
     atgccagcca ctcccagctc gcccatgtat gtcgactgat accgctgcta catcagactc      1260
     tagaaaaaag ggctgagggg aagcaagacg taaagagttt tcatcctgta tcacagtgtt      1320
     tttattgctc gcccagacac catgtgcaat aagactggtg ttcgtttcca tcatgtctgt      1380
     atacttctgt catctagact gtgcatccct gtaatacctg actgatcaca gtgttagtgc      1440
     tggtcagaga gacctcatcc tgctcttttg tgatgaacat attcatgacg cgtggaagtc      1500
     agtacgatca agttgttgac tgtgattaga tcacacctta attcatttct agactcaaaa      1560
     cctggagacg cagctactgg aatggtgttt tgtgagactt ccaaggctgg aaagacacag      1620
     tcatggatgt actgtctgag catagagaac ccgggcttga gtgagaagag cttgcacagc      1680
     cagtgagaca cattgccttc tgcagctggg agacagagga aggattccct ttcttcacca      1740
     agtgcaatag atttcctcat ctgataggct gttgctttac cgtcacacgc gatgtgctca      1800
     gccaaattcc ctactcaaaa tatcatgtta aattagaatt tatctttacc aaaaaccatg      1860
     ttgctttcag agaggtcaac attaaaatac tgagacagga cagaatgtgt tctttgtcct      1920
     tttccagccc tgctcttctc tgggaagata caggagtctg ccacctgtca tagaagggtg      1980
     ctgccaactt gatgctctac ctgccaccaa ccaccaggac tgaaggaagg aaacagtact      2040
     gagggcaaag tttacagatg tttttgattc tggcattttg tccagaacag cttgtagcag      2100
     ctatagattc ccccttggcc ccaagcctgg gacttgagcc atcgtaactc actaacaggg      2160
     agaattagct agtagcaatg tgccttgatg aagatttcct gcaggcagca aaacaccaaa      2220
     tcacaacgct ttgcttctcg acatcatggg ccaggtcctc agtttctaac tctttccctt      2280
     ccccacagtt cgttgtcgcc atgcggcttt tgctcagtct agtattctgc cttgtttttc      2340
     acattgggaa ccctaacatt accagggatg ctacttacca caatttgtaa ccctgaatct      2400
     ctcctgtgct ctggtgttca gaaagctgag acagctgggc ccagttgatg ttgtacgtga      2460
     gaaagaggca gtctgttgga gaggcatact tgagcaggat aaagatccta aatggcagcc      2520
     tttcagatag gcatgtctga cacctgctga ggcctctacc agttcactct ctcccttgga      2580
     agtggaattc tacccaccta aacccccc                                         2608
//

If you have problems or comments...

PBIL Back to PBIL home page