(data stored in ACNUC9306 zone)

EMBL: AK045998

ID   AK045998; SV 1; linear; mRNA; HTC; MUS; 2471 BP.
XX
AC   AK045998;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male corpora quadrigemina cDNA, RIKEN full-length
DE   enriched library, clone:B230331P16 product:neurofibromatosis 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2471
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1356c0a6fe81c59d21d8737a60f6f131.
DR   Ensembl-Gn; ENSMUSG00000009073; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017989; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017926; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017930; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018382; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017899; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017846; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017085; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017359; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109910; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027828; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027797; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027758; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027170; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027503; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027598; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026858; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027085; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B230331P16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2471
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B230331P16"
FT                   /tissue_type="corpora quadrigemina"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        382..2157
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="neurofibromatosis 2 (MGD|MGI:97307 GB|NM_010898,
FT                   evidence: BLASTN, 99%, match=1747)"
FT                   /note="putative"
FT                   /db_xref="GOA:P46662"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:97307"
FT                   /db_xref="PDB:1ISN"
FT                   /db_xref="PDB:3WA0"
FT                   /db_xref="PDB:4P7I"
FT                   /db_xref="PDB:4ZRK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46662"
FT                   /protein_id="BAC32567.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHN
FT                   TIKKPQAQGRRPICI"
XX
SQ   Sequence 2471 BP; 651 A; 602 C; 698 G; 520 T; 0 other;
     gaactactgc gcggccccgc gaccctcggg ggtcgctgag aggcccggcg tcggcgccgc        60
     agccgtctag gatttctgtc caaaggcgtc cctggcgtcc ccagcccgaa gctccaagct       120
     cggggctgcg cgtgcttttg ccggcatctc cccccgaccc ccccgtcgtc agagactgtc       180
     ccttaactca tctttccgca cccacagccg ggtcctcgcg gcccatgctg gccgctgggg       240
     acccaggcag cctaggtctg tctcgggccg gccagccggc caccatggtg gccctgaggc       300
     ctgtgcagct actccagggg ggctaagaga cccagaacgc gggcctaggg gtgaggggat       360
     ccaaggccgg tacctcgcgc catggccgga gccatcgctt ctcgcatgag cttcagctca       420
     ctcaagagga agcagcccaa gacattcacg gtgcggatcg tcaccatgga cgccgagatg       480
     gagttcaact gcgagatgaa atggaagggg aaggacctgt ttgatttggt gtgccggaca       540
     ctggggcttc gggaaacctg gttctttgga ctgcagtata caatcaagga cacggtggcc       600
     tggctcaaaa tggacaagaa ggtgttggat catgatgttt cgaaggaaga accagttacc       660
     tttcacttcc tggccaaatt ttatcctgaa aatgctgagg aggagctagt tcaagagatc       720
     acgcaacact tatttttctt acaggtgaag aagcagattt tggatgaaaa ggtctactgc       780
     cctcccgagg cgtccgtgct cttggcgtca tatgctgtcc aggccaagta tggcgactat       840
     gacccctctg tgcacaagcg gggattttta gcccaagagg aattgctccc gaaaagggtg       900
     ataaatctct atcagatgac tccggaaatg tgggaggaga gaattacggc ttggtatgcg       960
     gagcaccggg gcagagccag ggatgaagct gaaatggagt atttgaagat agctcaggac      1020
     ctggagatgt atggtgtgaa ctactttaca atccggaata aaaagggcac agagttgctg      1080
     cttggagtgg atgctcttgg gcttcatatc tatgaccctg agaacaggct gacccccaag      1140
     atctccttcc catggaatga aatccgaaac atctcctaca gcgacaagga gtttactatt      1200
     aaaccactgg ataagaaaat tgatgtcttc aaatttaact cctcaaagct tcgtgttaat      1260
     aagctgattc ttcagctatg tattgggaac catgacctat ttatgaggcg acggaaagct      1320
     gactctttag aagttcagca gatgaaagcc caggccaggg aagagaaggc tagaaagcag      1380
     atggaaaggc agcggctggc tcgagagaag cagatgcggg aggaggccga gcgtacaaga      1440
     gatgagttag agaggaggct cctgcagatg aaagaagaag caacgatggc caatgaagct      1500
     ctgatgcgct ctgaggagac agctgatctg ttggctgaaa aggctcagat cacagaggag      1560
     gaggccaagc ttttggcaca aaaggctgca gaggctgagc aagagatgca gcgaatcaag      1620
     gccacggcca ttcggacaga ggaggagaag cgcctgatgg agcagaaggt gctggaggct      1680
     gaagtgctgg cattgaagat ggctgaggag tcagagagga gggccaagga ggctgatcag      1740
     ttaaagcaag acttgcaaga agccagagaa gcagagcgaa gagccaagca gaagctctta      1800
     gaaatcgcca ccaagcccac ctatccaccc atgaacccaa ttccaccacc actgcctcct      1860
     gacataccga gcttcgacat tattgctgac agcttgtcat ttgacttcaa ggatacggac      1920
     atgaagcgac tttccatgga gatagagaaa gaaaaagtgg agtacatgga gaagagcaag      1980
     cacctgcagg agcagctcaa cgagctcaag acggagatcg aggccttgaa actcaaagag      2040
     cgggagacgg ccttggacgt cctacacagc gagagctcag acagaggcgg ccccagcagc      2100
     aagcataata ccattaaaaa gcctcaagcc caaggcagaa gacctatctg catttgagtc      2160
     ctcaaagaca atgtgtctac tgtctaacct tggatgaaca atttagaatg cacctgtctc      2220
     agcctcctta atgctggaat tataggcatg tgcctgcctt agcttcttgt cttttgttca      2280
     tttgtttggt ttggtattta aaatagggcc ttgctgtgta gttctggctg gtctggcatt      2340
     ctctatgcca gcctggcctc aaatgctgta ctatgcctgc ctctgcctcc caagtactgg      2400
     gaattcaggt atgcaggcct gtcctattat ggaaacagat gtatctccca aatccaaact      2460
     tgtttagatt t                                                           2471
//

If you have problems or comments...

PBIL Back to PBIL home page