(data stored in ACNUC31108 zone)

EMBL: AK053788

ID   AK053788; SV 1; linear; mRNA; HTC; MUS; 2037 BP.
XX
AC   AK053788;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130308I04 product:weakly similar to PLATELET-ENDOTHELIAL
DE   TETRASPAN ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1) (CD151
DE   ANTIGEN) [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2037
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9016637565f64c7e7173669c69e5a706.
DR   Ensembl-Gn; ENSMUSG00000030351; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031124; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030485; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032501; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080398; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079051; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130308I04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2037
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130308I04"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        256..1017
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
FT                   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1)
FT                   (CD151 ANTIGEN) [Homo sapiens] (SWISSPROT|P48509, evidence:
FT                   FASTY, 59.2%ID, 94%length, match=714)"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="BAC35523.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
FT   regulatory      2008..2013
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2037
FT                   /note="putative"
XX
SQ   Sequence 2037 BP; 436 A; 584 C; 576 G; 441 T; 0 other;
     tcagtgtgct ctgctttggg tgggaaaaaa aaaaagccag ctccaaacaa agagcagccc        60
     cggtcccgcc cgccccgggc ctgtgggcgc gtcccccagt ctgagtgaga ggggcagcca       120
     gcagccaccg cgggccagtg ggcaaggagc gcagggtgga gcgggcggct gtggccagga       180
     cagccacaat cacagctccg gattcccgat ccctcgctgc atccagcctg gcggttttgg       240
     ccgggtccag ccgccatggc gcactgcaag acagagcagg atgactggct gctggcccac       300
     ctgaagtacc tgctcttcat cttcaacttc ttcttctggg taggtggggc agccgtcatg       360
     gccgtgggta tctggacact ggtggagaag agcggttacc tcagcatctt ggcctccagc       420
     acgttcgctg cctctgccta catcctcatt ttcgttggtg gtcttgtcat gacaactggc       480
     ttcctgggct ttggggccat catccgggag cagaagagct gcctctccac atatttctgc       540
     ctgctgctgg tcatcttcct tgtggagctg gtggcagggg tcctggcaca tgtgtactac       600
     cagaggctga gtgacgagct gaagtggcac ctgaacagca ccctgactga gcactacgga       660
     cagcccaggg ccgcagagat cacagcctcg gtggaccggc tgcagcagga cttcaaatgc       720
     tgtggcagta acagctcagc cgactggcag cacagcgcgt acatcttgtc tcaggaagcc       780
     ctgggtcgcc aggtgcccga cagctgctgc aagacagtgg tggcccgctg tggtcagcga       840
     gcccacccct ccaacatcta caaggtagag ggaggctgta tggccaagct ggaacagttc       900
     gtggctgacc acctgctgct catgggagcg gtgggtattg gggtagcctg tcttcagatc       960
     tgtgggatgg tcctcacctg ctgcttgcac cgaaggctcc agcaacaatt ttattaaagg      1020
     acacccatgt accctgctga ctggcccacc caagggacca catctccact tcctgaacca      1080
     ggcctgcaaa gtcatcgctg gggctgtgga ctcgctccac cctatgcaga ggccaccaaa      1140
     tgtctgtggt tgtggttcct gtgcatcccg actggcaggg gcctcagcta actcctccat      1200
     tcctaagtac tcagccactg ccaaaatcct tgccaaggga tgatcctggc cagaggcagc      1260
     cagagccctt tgccaggcac tgggacgctg tggactacag gggggccaga gctcatctcc      1320
     ctctgatcca tctcagtgtc tgagtctgga atagaaggcc gtcggatggt ccctctgaga      1380
     gtcctatagg gcttggcgtg tgattcccac tggcatgtgg ccccaggctg gctctccttt      1440
     gggaaaacca gcactttggg cagaccaggt tagctcagcc ttttccaaaa cctggctggt      1500
     ttttcaatct ctccacagaa tagctggcca agaccttcct gtaaggtata gggcagaagt      1560
     gatcaaaggt ggggcatctt aaggtagctg ttgaagccaa cagcacaggg cactaaggaa      1620
     gcaggttggt cacaacacct aggaaagtca cacgatggtc acaatcccca gcctctggtc      1680
     ctgttcccag gcttgacttc caaaatgtca ggcttaaaat gttagtgaat gtaaaactat      1740
     ctcctcgacc aggtgggggg cacaccacag tctcagctgc tgaggagagg atgcgacgct      1800
     acggggaagg aggaactctg cctgcacccc atctcctggt gcccttgtga cctcactgtt      1860
     tctcttccat gcattctcca cttccttgtc cactgtgctg gagtagatgc cggcccttcc      1920
     ttcgctcctc tctttagtca cggaatgaca caggagattc aaggagaact catgtgttaa      1980
     aagacacgga aagaaaattc tagaaaaatt aaaggttgat agtaggtatc atagacg         2037
//

If you have problems or comments...

PBIL Back to PBIL home page