(data stored in ACNUC8465 zone)

EMBL: AK057521

ID   AK057521; SV 1; linear; mRNA; STD; HUM; 1491 BP.
XX
AC   AK057521;
XX
DT   31-OCT-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens cDNA FLJ32959 fis, clone TESTI2008237, highly similar to Dual
DE   specificity mitogen-activated protein kinase kinase 5 (EC 2.7.12.2).
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1491
RA   Isogai T., Otsuki T., Sugiyama T.;
RT   ;
RL   Submitted (24-OCT-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Ishibashi T., Kanehori K., Yosida M., Watanabe S., Ishida S., Ono Y.,
RA   Hotuta T., Hiraoka S., Murakawa K., Takiguchi S., Kusano J., Watanabe M.,
RA   Fujimori K., Tanai H., Ishida M., Yamashita H., Chiba Y., Sugiyama T.,
RA   Irie R., Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Matsuo K., Nakamura Y.,
RA   Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Takahashi-Fujii A.,
RA   Oshima A., Sugiyama A., Kawakami B., Suzuki Y., Sugano S., Nagahari K.,
RA   Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 8b3085dd6c234e0fddd6bb65bd8a4124.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: RAB and HRI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1491
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TESTI2"
FT                   /clone="TESTI2008237"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        352..1128
FT                   /codon_start=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   protein kinase kinase 5 (EC 2.7.12.2)"
FT                   /db_xref="GOA:B3KQ65"
FT                   /db_xref="H-InvDB:HIT000014135.16"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B3KQ65"
FT                   /protein_id="BAG51927.1"
FT                   /translation="MEDFEVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVEN
FT                   RISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNILVNTR
FT                   GQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGR
FT                   FPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEE
FT                   LMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP"
XX
SQ   Sequence 1491 BP; 397 A; 310 C; 380 G; 404 T; 0 other;
     aaactgaatc acctgcaggg tctgacgcct gcatggaatg atgagggaaa tttaattttc        60
     caagcaaagt gtgaagtgtg tgccactcca gcaaataaac gaagtcatcc atgacagctt       120
     gtgatgaatt gccgtattta tactgtatat tttaatagcc tcacactaat ttaaattgag       180
     tacagagtaa attataattc agtcacttga ctgcttatat ttaacttgac aactcatcct       240
     tatttgtcct ggaggtgtag tggagagcag tggaaatgca ccaaggagat gagggatgca       300
     tgctcaaggc agaatgtaca tattgagggc cagagctaga gatgaatttt gatggaggac       360
     tttgaggtca tactactaga tattacactg gaacttcaga agcaaattat gtctgaattg       420
     gaaattcttt ataagtgcga ttcatcatat atcattggat tttatggagc attttttgta       480
     gaaaacagga tttcaatatg tacagaattc atggatgggg gatctttgga tgtatatagg       540
     aaaatgccag aacatgtcct tggaagaatt gcagtagcag ttgttaaagg ccttacttat       600
     ttgtggagtt taaagatttt acatagagac gtgaagccct ccaatatact agtaaacaca       660
     agaggacagg ttaagctgtg tgattttgga gttagcactc agctggtgaa ttctatagcc       720
     aagacgtatg ttggaacaaa tgcttatatg gcgcctgaaa ggatttcagg ggagcagtat       780
     ggaattcatt ctgatgtctg gagcttagga atctctttta tggagcttgc tcttgggagg       840
     tttccatatc ctcagattca gaaaaaccag ggatctttaa tgcctctcca gcttctgcag       900
     tgcattgttg atgaggattc gcccgtcctt ccagttggag agttctcgga gccatttgta       960
     catttcatca ctcagtgtat gcgaaaacag ccaaaagaaa ggccagcacc tgaagaattg      1020
     atgggccacc cgttcatcgt gcagttcaat gatggaaatg ccgccgtggt gtccatgtgg      1080
     gtgtgccggg cgctggagga gaggcggagc cagcaggggc ccccgtgagg ctgccgcagg      1140
     gcactgaaag cccaggacca gtaaccaagg agaacaaccc acccgtcgcc cttctccgta      1200
     tgctgcctgc gccagaagag ctttgctggg ccctggcttc cctgccctcg ccttcacctc      1260
     tgtcagcagg tggccttgcc tggggagccc catgtgtggc ccaccccacc aggccatccc      1320
     cataccttct ggtttgaagg cgctgacact ggcagagagg taaagggtgg ggcattgaga      1380
     atggaggctc ccagggtccc tgcccacttc tgttttccta atgtttttct ctataaaggg      1440
     tcaggcccgt cagcatcact gatgggaata aaagtattaa tgctttgtga c               1491
//

If you have problems or comments...

PBIL Back to PBIL home page