(data stored in ACNUC24361 zone)

EMBL: AK057702

ID   AK057702; SV 1; linear; mRNA; STD; HUM; 1947 BP.
XX
AC   AK057702;
XX
DT   31-OCT-2001 (Rel. 69, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens cDNA FLJ33140 fis, clone UTERU1000160, moderately similar to
DE   ZINC FINGER PROTEIN 191.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1947
RA   Isogai T., Otsuki T., Sugiyama T.;
RT   ;
RL   Submitted (24-OCT-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Oshima A., Takahashi-Fujii A., Tanase T., Imose N., Takeuchi K., Arita M.,
RA   Musashino K., Yuuki H., Hara H., Sugiyama T., Irie R., Otsuki T., Sato H.,
RA   Wakamatsu A., Ishii S., Yamamoto J., Isono Y., Kawai-Hio Y., Saito K.,
RA   Nishikawa T., Kimura K., Yamashita H., Matsuo K., Nakamura Y., Sekine M.,
RA   Kikuchi H., Kanda K., Wagatsuma M., Murakawa K., Kanehori K., Sugiyama A.,
RA   Kawakami B., Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K.,
RA   Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 74a22f840b7c913085a68ce27a0a2922.
DR   Ensembl-Gn; ENSG00000235109; homo_sapiens.
DR   Ensembl-Tr; ENST00000344279; homo_sapiens.
DR   Ensembl-Tr; ENST00000396838; homo_sapiens.
DR   Ensembl-Tr; ENST00000414429; homo_sapiens.
DR   Ensembl-Tr; ENST00000439158; homo_sapiens.
DR   Ensembl-Tr; ENST00000446474; homo_sapiens.
DR   Ensembl-Tr; ENST00000611469; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: RAB and HRI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1947
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="UTERU1"
FT                   /clone="UTERU1000160"
FT                   /tissue_type="uterus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        527..1747
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96LW9"
FT                   /db_xref="H-InvDB:HIT000014309.18"
FT                   /db_xref="HGNC:HGNC:14097"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96LW9"
FT                   /protein_id="BAB71548.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALNRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHRFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
XX
SQ   Sequence 1947 BP; 590 A; 458 C; 474 G; 425 T; 0 other;
     cagagagaga gagaaaaact gctgaccctg taagagagaa ctggccatct tgcagacaga        60
     cagagccccg agtgttcttt caactacctg ccacccatcc aacaactccc ctcggacctc       120
     agtatgggct ggaacctgac acttggcatg acagtgaccc caggcatcca aaccatgaca       180
     gttccatcag ctctccaaat gagagacgga gtctcgctat gtcgcccggg cttgtcttga       240
     actcctggac tcaggagatc ctcccatctc ggcctctcaa agtgttggga ttacaggcgt       300
     gagctattac acctgactta agtctccatt ttcatatcta tactttggga ttccagaaga       360
     cagaggtttg agtgtaaaac acaaaataac aaaaccacaa caaaaacaac tctgtattct       420
     cgtccccacc attaccatct ctcccttgtg atgtcaaaga gaccagagga agtggacaga       480
     ctcggggaag aatagccaga gtaagccttc caaattaacc ccaggaatgg cttcaacaga       540
     ggaacagtac gatcttaaga ttgtgaaagt ggaggaagac cctatctggg accaagaaac       600
     ccaccttcga gggaacaact tttctggcca agaagcctcc cgacaacttt ttaggcagtt       660
     ttgttaccaa gagactcctg gtccccgaga agctctgaac cggctccgag aactctgtca       720
     tcagtggcta aggccagaaa tccacaccaa agagcaaatc ttggagctgc tggtgctgga       780
     gcaattcctg actatcctgc ctgaggagct ccaggcctgg gtgcgggagc accatccgga       840
     gagtggggag gaggctgtgg ctgtagttga agatctggaa caagagctta gtgagccagg       900
     gaaccaggct ccagaccatg aacatggaca ttctgaagtg ctcttggagg atgtggaaca       960
     tctgaaggtc aagcaggaac caacagacat acagcttcag cctatggtga cacagctcag      1020
     atatgaatct ttttgcctcc accgatttca agaacaagat ggtgaaagta tacctgagaa      1080
     ccaggagttg gcatcaaagc aagaaatctt aaaagaaatg gaacatttgg gggatagcaa      1140
     actccaaaga gatgtatctt tggattctaa gtacagagaa acttgtaaac gagacagcaa      1200
     ggcagaaaag cagcaggcac attccactgg agagagacgc cacaggtgca atgaatgtgg      1260
     gaaaagcttc actaagagtt cagtactcat tgagcaccag agaatccaca ctggggagaa      1320
     gccatatgaa tgtgaagaat gtgggaaggc cttcagccgg aggtcaagcc tgaatgaaca      1380
     tcggcggagc cacactggag agaaacccta tcaatgtaag gagtgtggga aagccttcag      1440
     tgccagcaat ggcctcactc gacacagaag aatccacaca ggggaaaaac catatgaatg      1500
     caaagtgtgt gggaaggctt tcctcctcag ctcatgcctt gttcagcatc agaggataca      1560
     cactggagag aagcgctatc agtgtcgtga gtgtggcaaa gccttcattc agaatgcagg      1620
     gcttttccag catctccgag tccacactgg tgagaaaccc tatcagtgca gtcagtgcag      1680
     taaactcttt agtaagcgga cacttcttaa gaaacatcag aaaatccaca ctggagagag      1740
     accataaggg tgatgagttt gggaaagcct tcagtcatca ttgcaacctt attaggcatt      1800
     ttagaatcca tactgttcca gcagaactgg actaattctg tggaccctca gacccctaaa      1860
     tggggccgtc ttggaaagta agattttcaa gtggcttatt ctgttcttat aaaatttatt      1920
     ttgtattgca ttgaaccact tgtctac                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page