(data stored in ACNUC5340 zone)

EMBL: AK060981

ID   AK060981; SV 1; linear; mRNA; STD; PLN; 801 BP.
XX
AC   AK060981;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:006-202-H08, full insert sequence.
XX
KW   FLI_CDNA; oligo-capping.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-801
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakamura M., Namiki T., Narikawa R.,
RA   Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E., Ohno M.,
RA   Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R., Saitoh H.,
RA   Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K., Satoh K.,
RA   Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y., Sugano S.,
RA   Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y., Tagawa A.,
RA   Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T., Tsunoda Y.,
RA   Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M., Yasunishi A.,
RA   Yazaki J., Yokomizo S., Yoshimura A.;
RT   ;
RL   Submitted (05-DEC-2001) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; c76255df4fcd7531593ca6752775d072.
XX
CC   This clone is one of the 28K full-length cDNA clones from japonica
CC   rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
CC   and Yamamoto,M.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="006-202-H08"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        79..456
FT                   /note="(RAP Annotation release2) Similar to
FT                   Dormancy-associated protein"
FT                   /note="(Rice Genome Annotation Project) auxin-repressed
FT                   12.5 kDa protein, putative, expressed"
FT                   /note="mapping to R11-TIGRv4S1-000792R (Chr.11: short
FT                   arm=26609698, long arm=26611192, direction=reverse) for
FT                   TIGR Pseudomol ver4"
FT                   /db_xref="InterPro:IPR008406"
FT                   /db_xref="UniProtKB/TrEMBL:Q2QZU5"
FT                   /protein_id="BAG87655.1"
FT                   /translation="MLEKLWDDVVAGPRPETGLEKLRKAATTRPLVINKDGDGEASGAA
FT                   YKRTQSMPTTPTTPVTPSSSSPTTTATTTPRGSNVWRSVFHPGSNLATKSLGANLFDRP
FT                   QPNSPTVYDWLYSDETRSSHR"
XX
SQ   Sequence 801 BP; 177 A; 217 C; 223 G; 184 T; 0 other;
     acttgggagg cagtgagttg ttgtaaagtt gcaagagaga gatcagttgt tgagtgcgtg        60
     gaagcagaga tcaggaagat gctggagaag ctgtgggacg acgtggtggc cgggcctcga       120
     ccggagaccg gcctggagaa gctccgcaag gccgctacaa cccgccccct tgtcatcaac       180
     aaagatggcg acggcgaggc gagcggggcg gcgtacaagc ggacgcagtc gatgccgacg       240
     accccgacga cgccggtgac gccgtcgtct tcgtctccga cgacgacggc gacgacgacg       300
     ccgcggggca gcaacgtgtg gaggagcgtg ttccacccgg ggagcaacct cgccaccaag       360
     agcctcggcg ccaacctctt cgaccgcccg cagcccaact cccccaccgt ctacgactgg       420
     ctgtacagcg acgagaccag gagcagccat cgctgaacta aataatccca ttgatcggag       480
     gctggtcgat ctctctgtca cgccacgttt gctggtcctt gtggttatct aatacgtaat       540
     taattatcta gtatgttgct atcttatctt gttactctgt tcctagtagc ttgctgtctc       600
     tgttagtact accagagacc ggtacgtgtc agctagcctg ctggctccta tcaagggcta       660
     gcgacaaccc aaagaagtgt gtttgtgtgt aaacatcttc catgtgtaaa tactgccatg       720
     tgtttcccta ctttcagcgt ttaattacct ttgatgtgat aataccaata ccagcttgag       780
     atatttcttc ttggttgcaa t                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page