(data stored in ACNUC13479 zone)

EMBL: AK067169

ID   AK067169; SV 1; linear; mRNA; STD; PLN; 1138 BP.
XX
AC   AK067169;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:J013098B11, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-1138
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakamura M., Namiki T., Narikawa R.,
RA   Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E., Ohno M.,
RA   Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R., Saitoh H.,
RA   Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K., Satoh K.,
RA   Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y., Sugano S.,
RA   Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y., Tagawa A.,
RA   Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T., Tsunoda Y.,
RA   Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M., Yasunishi A.,
RA   Yazaki J., Yokomizo S., Yoshimura A.;
RT   ;
RL   Submitted (05-DEC-2001) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; 0c780de82a58e10d6c4ba4e3d8947469.
XX
CC   This clone is one of the 28K full-length cDNA clones from japonica
CC   rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
CC   and Yamamoto,M.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1138
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="J013098B11"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        180..950
FT                   /note="(RAP Annotation release2) Conserved hypothetical
FT                   protein"
FT                   /note="(Rice Genome Annotation Project) signal recognition
FT                   particle receptor beta subunit, putative, expressed"
FT                   /note="mapping to R08-TIGRv4S1-000811R (Chr.8: short
FT                   arm=25913952, long arm=25916820, direction=reverse) for
FT                   TIGR Pseudomol ver4"
FT                   /db_xref="GOA:Q6ZK21"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZK21"
FT                   /protein_id="BAG90299.1"
FT                   /translation="MDEWVRQAEVWVGQAERWIRQQPPEQVYVAVAVVAVTVLLLVAVS
FT                   CLKSSKANTIVLSGLSGSGKTILFYQLRDGSTHQGTVTSMEQNNDTFVLHSELERRGKV
FT                   KPVHVVDVPGHARLKPKLDEVLPQAAGIVYVVDAQDFLSTMHAAAEYLYDILTKATVVK
FT                   KRVPVLIFCNKTDKVTAHSKEFIKKQLEKELNKLRESRNAISSADITDEVKLGNPGEAF
FT                   NFSQCQNKVTVTEGAGLTGNVSAVEEFIREYVKA"
XX
SQ   Sequence 1138 BP; 284 A; 272 C; 301 G; 281 T; 0 other;
     gtcctgctcg gcttcccccc caacccccgc cttctcccct ccgactccgg ccacctccgc        60
     ggcggcggag catcctaggg tttcgcgccg gctcgccgcc ggcgtacgga gagggagggt       120
     gtaacacgcg caggcctgcg ccgtcgtcct gctctgggaa cttccgcgtg cagcgaggga       180
     tggacgagtg ggttcgccag gccgaggtgt gggtgggaca agccgagagg tggatccggc       240
     agcagcctcc cgagcaggtt tacgtcgccg tcgcggtggt cgccgtgacg gttctgttgc       300
     tggtcgcagt ttcgtgcctg aaatcctcga aagcaaacac catagtgcta tctgggctca       360
     gtggtagtgg caaaactatt ctcttctacc agcttcggga tggatcaaca catcaaggaa       420
     ctgtgacttc aatggaacaa aacaacgata ctttcgtgct tcattctgag ctggagagga       480
     gaggcaaagt aaaacctgtt catgttgttg acgttcctgg tcatgcaagg ctcaaaccca       540
     aacttgatga agtcctgcct caagcagctg gaatagttta tgttgttgat gctcaagatt       600
     tcttgtctac catgcatgct gctgcagagt acttgtatga catcctgaca aaggcaactg       660
     tagtgaagaa gagggttcct gttctgatat tctgcaacaa gacagataaa gttacagctc       720
     actcaaaaga attcatcaag aagcaattgg aaaaggaatt aaacaagctc cgggaatcaa       780
     ggaacgccat atcatctgct gacatcactg atgaagtcaa gcttgggaac cctggagaag       840
     catttaattt cagccaatgc cagaacaagg tgacagttac tgaaggtgct ggtctgaccg       900
     gtaatgtttc agcggttgag gagttcattc gtgagtatgt gaaagcttag gccttagagt       960
     tgtcggacct ttacagaata gagtttgtat tcgttcaaaa ttgtcatcta agcggagact      1020
     gattttcctg atggaagaag gaaaaccttc atcatctcat ctgcatctgc ttcattccat      1080
     tcatgcgtgt gagaaatttc aacattttct tgaaaggaaa gcatcggaca ttcagttg        1138
//

If you have problems or comments...

PBIL Back to PBIL home page