(data stored in ACNUC1829 zone)

EMBL: AK075547

ID   AK075547; SV 1; linear; mRNA; STD; HUM; 2872 BP.
XX
AC   AK075547;
XX
DT   07-SEP-2002 (Rel. 73, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens cDNA PSEC0247 fis, clone NT2RP3001613, weakly similar to
DE   PLATELET-ENDOTHELIAL TETRASPAN ANTIGEN 3.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2872
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (20-MAR-2002) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Ota T., Nishikawa T., Suzuki Y., Kawai-Hio Y., Hayashi K., Ishii S.,
RA   Saito K., Yamamoto J., Wakamatsu A., Nagai T., Nakamura Y., Nagahari K.,
RA   Sugano S., Isogai T.;
RT   "HRI human cDNA sequencing project";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1093/dnares/12.2.117.
RX   PUBMED; 16303743.
RA   Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J.,
RA   Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S.,
RA   Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.,
RA   Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S.,
RA   Isogai T.;
RT   "Signal sequence and keyword trap in silico for selection of full-length
RT   human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA
RT   libraries";
RL   DNA Res. 12(2):117-126(2005).
XX
DR   MD5; 59520e9d32242d8ff97230eaea8dd144.
DR   Ensembl-Gn; ENSG00000157570; homo_sapiens.
DR   Ensembl-Tr; ENST00000340160; homo_sapiens.
DR   Ensembl-Tr; ENST00000520358; homo_sapiens.
XX
CC   HRI human cDNA sequencing project; cDNA 5'- & 3'-end one pass
CC   sequencing, clone selection and full insert sequencing: Helix
CC   Research Institute (supported by Japan Key Technology Center
CC   etc.); cDNA library construction: Institute of Medical Science,
CC   University of Tokyo, Laboratory of Genome Structure, Human Genome
CC   Center.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2872
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP3"
FT                   /clone="NT2RP3001613"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        9..719
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96SJ8"
FT                   /db_xref="H-InvDB:HIT000082580.13"
FT                   /db_xref="HGNC:HGNC:20660"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96SJ8"
FT                   /protein_id="BAC11690.1"
FT                   /translation="MFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYI
FT                   LLAMGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREF
FT                   FTKELTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEA
FT                   CCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIEL
FT                   FAMIFAMCLFRGIQ"
XX
SQ   Sequence 2872 BP; 608 A; 916 C; 704 G; 644 T; 0 other;
     aaaaactgat gtttgtattc aatttcttca tatttctggg cggggcctgc ctgctggcca        60
     tcggcatctg ggtcatggtg gaccccaccg gcttccggga gatcgtggct gccaatcctc       120
     tgctcctcac gggcgcctac atcctcctgg ccatgggggg cctgctcttt ctgctcggct       180
     tcctgggctg ctgcggggcc gtccgtgaga acaagtgtct gctgctattt ttcttcctgt       240
     tcatcctgat catcttcctg gcagagctct cagcagccat cctggccttc atcttcaggg       300
     aaaatctcac ccgagaattc ttcaccaagg agctcaccaa gcactaccag ggcaataacg       360
     acacagacgt cttctctgcc acctggaact cggtcatgat cacatttggt tgctgcgggg       420
     tcaacgggcc tgaagacttt aagtttgcat ctgtgtttcg actcctgacc ctggatagtg       480
     aagaggtgcc ggaggcctgc tgccggaggg aaccccaaag tcgggacggg gtcctgctga       540
     gccgggagga gtgcctcctg ggaaggagcc tattcctaaa caagcagggc tgttacacgg       600
     tgatcctcaa caccttcgag acctacgtct acttggccgg agcccttgcc atcggggtac       660
     tggccatcga gcttttcgcc atgatctttg ccatgtgcct cttccggggc atccagtaga       720
     gggtatggcc tgaagcctga agactcgccc cacccaccac tgcccagcac ccaatgtcct       780
     cccgtgcccc tccccgctgt cctcttggcc ccaggggaga agatgaggcc atcagagatg       840
     gccaggagaa gggccagggg aatagagcta tttttttaac aaaacaaaat gaagacaaaa       900
     atatggactg atgtatcctc gcctggactc agggcaggtg ccgtgggttc tccagagacc       960
     ccagcacctg gcccaggatg caggctgctc tagagaccaa aggaacacca ggcccagcgc      1020
     cctctttggt ccagccagac cctgggccct ctctcctcac tgcaccagga cctgatgcca      1080
     agaaagtgag gatttaggca acaaggaggc aaaagcaaat ctcagagaag tcatcaaagc      1140
     ccaggggctg cacggagatt cagctgccat gtctttgagg actcggaacc cacagcgcaa      1200
     tccctggtcc actggaggat ggactgttcc ccccttcagg ccggggccaa gagtgagctg      1260
     ctaacacggc atccaagaat ggcccagctg gtaggatcct tgctttcccc atctgttgga      1320
     ccaaataatc tcaaaggccc agagaggaca gtgaccatcc acagacacac agcacaggcg      1380
     tgacagttct gaaaagaagc tgagttgtct ccaggctgct gtcactgcat ccaggactct      1440
     gtcagctctg ctgcccacat gcacccctgg cctcagcatc ccggttcccc cagacaagag      1500
     agggcaagtc agccaggaac tgcctcctcc ctgctctaca gctaagaaaa caccattcca      1560
     tgacttccca ccgcgccctc gctcctacct ccccacacct ctctctcagt ccccaggaac      1620
     acacagaggt gcacatcaca ttcccttgtc cacactgccc gcctctccca catgccaccc      1680
     ccttccctgt ccttccccaa ctccccagct ccaagagtgg aagaaatccc caagatcatc      1740
     tgggtctccc tctccacacc cagaactgag gcttggatat cttcttcaac atccttgcca      1800
     agacttctcc accctcttgc atacctccag ggacagagag cttactacct cccaaggcag      1860
     cctcctgcct ttggactgct ctgactttag catcagctta atacacagaa gaggtttctg      1920
     tttttctgtg gctctgtcca tggcatccca cttgcccact ctccttcctg gagtgttgag      1980
     gtcacacatt gactcccctg agccctcttc tctccaggct aaagaatccc gaaggcatcg      2040
     aggccatttc tgctgcaaca aggtttcctg tctcttcact gtccgcacat ttcttagtat      2100
     tccctccagg cttgggcagg gagactcgca gatgcacacc cacaagtatt cagttctcaa      2160
     actctagacg agtgttggca actggattgc aagatgctcc taccctgata gatcaggggt      2220
     ggctgctgga ggctgtgctg gggatctgag gtttggtctg ggctcagtgg gagatggcag      2280
     tgcaatcctg atgagtgatg tctgccaggc accgtaagtt tgattagtga tgtctgccac      2340
     gggcagggat ggaaggagca gtgtgatgtc tgctctcttc tctcccctct gtccctcttc      2400
     aggaagaaag agctcattct gtctcacaag ccaccggcat cctgtatcag cttccagcct      2460
     cccctcaggc tttccagtca ccagggacac tcggagccac agcctagagc cccgtgttcc      2520
     ctggcctgtg cgtctgcccc cttctgagat gcagccagaa gctctgtgcc tgctgcaaag      2580
     attcaggtgg accctcctct aatctcctcc tgctgtgccc gccagtcctt gccctcccac      2640
     caggtctctg agctcagtct taccaaattc gccctttaac agcttgctct ggcaacccca      2700
     taaatgacac ctgagctccg tagaagctaa gctcctgaga cccaggggga cctgccactg      2760
     gtaccgcggc ccagcctggg gcctgggggc tgcccctctt gaaccaccca catgcttagc      2820
     cccagctttt tggaagaggc aaatggctgg tctgaggatg acacacaaaa ac              2872
//

If you have problems or comments...

PBIL Back to PBIL home page