(data stored in ACNUC13479 zone)

EMBL: AK075583

ID   AK075583; SV 1; linear; mRNA; HTC; MUS; 1877 BP.
XX
AC   AK075583;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610011C16 product:signal recognition particle receptor, B subunit,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1877
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8eef468c81da73f814c8ff83ba2e856d.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610011C16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1877
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610011C16"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        10..819
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="signal recognition particle receptor, B subunit
FT                   (MGD|MGI:102964)"
FT                   /db_xref="GOA:Q542X6"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102964"
FT                   /db_xref="UniProtKB/TrEMBL:Q542X6"
FT                   /protein_id="BAC35836.1"
FT                   /translation="MASANTRRVGDGAGGPFQPYLDSLRQELQQRDPTLLSVAVALLAV
FT                   LLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVN
FT                   NNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLID
FT                   SMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQ
FT                   LGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA"
XX
SQ   Sequence 1877 BP; 415 A; 508 C; 495 G; 459 T; 0 other;
     acctctttca tggcttcggc gaacacccgg cgagttggcg atggcgccgg tggccctttc        60
     cagccttacc tcgactcctt acgacaggag ctgcagcaga gggatccgac gctgctctcc       120
     gtggcggtgg ctctcctggc ggtgctgctg acgctggtgt tctggaagtt catctggagc       180
     cgaaagagca gtcagagagc tgttctcttc gttggtctct gtgactctgg gaaaacgttg       240
     ctgtttgtca ggttgctaac tggccagtac agagacacac agacttccat taccgatagt       300
     tctgccatat acaaagtcaa caataacagg ggtaacagcc tgactctgat cgacctcccc       360
     gggcatgaga gcttgaggtt tcagctctta gatcgcttta agtcttcagc tagggctgtg       420
     gtgtttgtgg tggacagtgc ggcgttccag cgggaggtga aagatgtggc cgaatttctg       480
     taccaggtcc tcatcgacag catggctctg aagaactcac cgtccttatt aatagcctgc       540
     aataagcaag atatcgcaat ggcaaaatca gcgaagttga tccagcagca gcttgagaag       600
     gagctcaaca ccttacgagt cacccggtcc gcggctccca gcacactgga cagttccagc       660
     accgcacctg ctcagttggg gaagaaaggc aaagaatttg aattttccca gttgccactc       720
     aaagtggagt tcctggagtg tagtgccaag ggtggacgag gggacactgg ctctgctgac       780
     atccaggact tggagaagtg gctggccaag attgcctgag gagcatcgct ggccacaagc       840
     gttggtcatg tgagactgac cctgcagttt gagaaagggc ggtggtggtg tggactgata       900
     aagagggggc atgtcgttga agcatttctt gagttcttga aacaattgta ccacccccac       960
     cccacccccg tcagctcctt tctcagctag tcctttctta attcccatat tctttctccc      1020
     tttgctaggt gttaggtgta gcatcatgtt agtgtgagac ataacagaga gggcatcgct      1080
     ttgagagtag ggtcgcatct gagaagtcct tgtctcctgc ctctgtgttg gtcccttttc      1140
     ctgggaccag atctgcctgc ttgtggaata agtgaacttg cagttgcccc tggtgtaggc      1200
     ataatacagt gtcagttctt agtggagtct ggggtgtgaa ggtctacagt gaagacagct      1260
     tcaaagccac aggcacagct gacagtgtgt ccttcacggg ctcagtgacc atcccacacc      1320
     accctagctg acagtgtgtc cttcacgggc tcggtgacca tcccacacca ccctagctga      1380
     cagtgtgtcc ttcacgggct cggtgaccat cccacaccac cctagctgac agtgtgtcct      1440
     tcacaggctc ggtgaccatc ccacaccacc ctagctgaca gtgtgtcctt catgggctcg      1500
     gtgaccatcc cacaccaccc tagctgacag tgtgtccttc acgggctcgg tgaccatccc      1560
     cacaccaccc taggttcaaa agtgccgcaa ccccgaagag tcaccctcac aaggtggctc      1620
     taggagccaa atccccagac actcctaggt tagtgttcta gaggctccac tggggagagc      1680
     agggagacag cacactgctg cctcgggcgt gcgtgagccc aggctgtccc ctgtgctact      1740
     tgatcagctc ctgttgtgtc accccagcta gagtgctatg gaacaataca aactgaagat      1800
     gtccactgtg cattttaaat acatatttat tcatgatgct ttaaaaaatg ttaccttttt      1860
     aaagtgatgc tgtcttc                                                     1877
//

If you have problems or comments...

PBIL Back to PBIL home page