(data stored in ACNUC1829 zone)

EMBL: AK079139

ID   AK079139; SV 1; linear; mRNA; HTC; MUS; 1442 BP.
XX
AC   AK079139;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 12 days embryo embryonic body between diaphragm region and
DE   neck cDNA, RIKEN full-length enriched library, clone:9430079M16
DE   product:TETRASPAN NET-5 homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1442
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 446ab81a306a5e093f2fda6416aed0d1.
DR   Ensembl-Gn; ENSMUSG00000030352; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031289; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031020; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030401; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030981; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031137; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031086; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030486; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112173; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080321; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080400; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080322; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080536; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079944; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080107; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079053; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9430079M16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1442
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9430079M16"
FT                   /tissue_type="embryonic body between diaphragm region and
FT                   neck"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        156..875
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="TETRASPAN NET-5 homolog [Homo sapiens]
FT                   (SWISSPROT|O75954, evidence: FASTY, 97.1%ID, 100%length,
FT                   match=717)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="BAC37559.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
XX
SQ   Sequence 1442 BP; 296 A; 408 C; 408 G; 330 T; 0 other;
     gggagcggag ccggggcgcc acaccgagtc caagcgcgcg ttgcagctgg cgaagacttg        60
     ggaagtcaga tccaagctgt cccctctcag aggagagtga gaggatccag ctcaggtgac       120
     ccaggcaggc agtcagagaa tttaagaagt gcaacatggc caggggctgt ctctgctgct       180
     tgaagtacac gatgttcctc ttcaatttga tattctggct ctgtggctgt gggctgcttg       240
     gagtgggcat ctggctctct gtgtcccaag gcaacttcgc caccttctcc cccagcttcc       300
     cctcactgtc cgcagccaac ctcgtcatcg ccatcggcac catcgtcatg gtgacgggct       360
     tcctgggctg cctgggggcc atcaaggaga acaagtgtct gcttctcagc ttcttcatcg       420
     tgctgttgat catcctgctg gcagagttga ttctgatcat cctcttcttc gtctacatgg       480
     acaaggtgaa cgagaatgcc aagcaggacc tgaaagaggg gctgctgctc tacaacacag       540
     agaacaacgt ggggctcaag aacgcctgga acatcatcca ggccgagatg cggtgttgtg       600
     gggtcactga ctacacagac tggtatccgg tgctcgggga gaacacagtt cctgacagat       660
     gctgcatgga gaattcccag ggctgtgggc gcaacagcac cacccccttg tggagaacgg       720
     gctgctacga aaaagtgaag ctgtggtttg atgacaacaa gcacgtgcta ggcaccgtgg       780
     gcatgtgcat cctcatcatg cagatcctgg gaatggcctt ttccatgaca ctgttccagc       840
     acatccaccg gacaggtaaa aagtacgacg cctgaggctg cggcagcgcc tggctccacc       900
     cggacactgc gtgtgccagg gaagaggacc cgagtcatgt ctcctgcctg ctctccgatg       960
     gccaccctgc accacctgcc ggcctgccct cccctgccca catccttggc cttagacctc      1020
     atggagggca gaggcccagg gatgaggcat catgcagaga cctcagggct tgggcaactg      1080
     gattcctgca cctgcagact tgccaaagat gccggggcgg gcagggtgtc agcgaggaag      1140
     ccccttcaac gatgggtgtc tgcccctggc cttcctcaca ctgacacttg ttcctatgtg      1200
     gggtggagag tctgccccat ggaggccact gccgtccatg gctgcccagc cagagagcct      1260
     gccagggtgc agtgtggcac cgccaggtca ggccccctgg agcaccctgc ccgggttttt      1320
     atactatagt gtaacttttt ttttttattt tactctgatt atgattattc aggaatatta      1380
     tctctcagat aagtttaggg ttagctctct gatttataac tttttactgt gttgatttcc      1440
     gt                                                                     1442
//

If you have problems or comments...

PBIL Back to PBIL home page