(data stored in ACNUC5448 zone)

EMBL: AK088732

ID   AK088732; SV 1; linear; mRNA; HTC; MUS; 2690 BP.
XX
AC   AK088732;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430024L14 product:KALIRIN-12A homolog [Rattus
DE   norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2690
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d470b060e9e867eb8204817e18790677.
DR   Ensembl-Gn; ENSMUSG00000061751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000232157; mus_musculus.
DR   EuropePMC; PMC4127147; 25014196.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430024L14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2690
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430024L14"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        149..2170
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="KALIRIN-12A homolog [Rattus norvegicus]
FT                   (SPTR|Q9JIF1, evidence: FASTY, 92.8%ID, 23%length,
FT                   match=1944)"
FT                   /note="putative"
FT                   /db_xref="GOA:A2CG49"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR028569"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="MGI:MGI:2685385"
FT                   /db_xref="PDB:1WFW"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2CG49"
FT                   /protein_id="BAC40535.1"
FT                   /translation="MKGGDQAYTRGPSLGWLFAKCCCCFPCRDSYSHSSSENGGKSESV
FT                   AHLQSQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFD
FT                   LGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTHDEMTLEGG
FT                   SYRGSLKDPTGCLNEGMTPPTPPRNLEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIV
FT                   VEGFMKRIEEKGVPEDMRGKEKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIK
FT                   HERKLHIYVWYCQNKPRSEYIVAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLL
FT                   LKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDT
FT                   FYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEDNVD
FT                   GDPCKFALMNRETSERVILQAANSDIQQAWVQDINQVLETQRDFLNALQSPIEYQRKER
FT                   STAVIRSQPPRVPQASPRPYSSGPVGSEKPPKGSSYNPPLPPLKISTSNGSPGFDYHQP
FT                   GDKFDASKNDLGGCNGTSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPA
FT                   SDHSPAAEGWVPGSILAPLAKATAAAESSDGSIKKEPY"
FT   regulatory      2674..2679
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2690
FT                   /note="putative"
XX
SQ   Sequence 2690 BP; 711 A; 681 C; 703 G; 595 T; 0 other;
     tgtaagttcc agcaccgccg gggtgcggga ggaggacggc aggcgggaac aggacctggc        60
     tggcgggtgg cactgaagtt tcctaccgcc gcgctctcac cccggccggc gttcgtgcca       120
     tgccggagca ctgggagcgc gctgcagcat gaagggtggc gatcaggctt acacccgagg       180
     tccctctttg ggctggctct ttgctaagtg ctgctgttgc ttcccttgta gagattcata       240
     ctctcattcc tccagtgaga atggaggcaa atccgagtcc gtggcccacc tgcagtctca       300
     gccctccctg aactccatcc acagttcccc tggtcccaag cgctccacca acaccctcaa       360
     aaagtggctg accagccccg tgcgccgcct caacagcgga aaagccgacg ggaacatcaa       420
     aaagcagaag aaagtccggg atgggcggaa gagcttcgat ctgggatcgc ccaagcctgg       480
     ggatgagacg acacctcagg gagacagcgc tgacgagaag agcaagaagg gttggggcga       540
     agacgagcca gatgaagagt cacacacacc cctccctccg cccatgaaga tctttgacaa       600
     cgaccccaca catgatgaga tgactctgga aggaggctct taccggggga gcttgaagga       660
     ccctacaggc tgcctgaatg aggggatgac ccctcccaca cctcctagaa acctggaaga       720
     agaacagaaa gccaaggcgc tgagaggcag gatgtttgtc ctgaatgagc tggtacagac       780
     agagaaggac tacgtcaagg acctggggat tgtggtggag ggcttcatga agagaataga       840
     agagaagggg gtccctgagg acatgcgagg gaaggaaaag atcgtgtttg gaaatatcca       900
     ccagatttac gactggcata aagatttttt cctggctgaa ctggaaaaat gtatccaaga       960
     gcaagacaga ttggcccagc tcttcattaa acacgagcgg aagctgcaca tctacgtgtg      1020
     gtactgccag aacaagccgc gttccgagta catcgtggct gagtacgatg cctattttga      1080
     ggaggttaaa caagagatca atcaaaggct gacccttagt gacttcctga tcaagcccat      1140
     tcagagaata acaaagtacc agctgctact caaggacttc ctgcgataca gcgagaaggc      1200
     tggtttggag tgttccgata ttgagaaagc agtggagtta atgtgccttg tccccaagcg      1260
     ctgtaatgac atgatgaatc tgggacgcct gcagggcttc gagggcaccc tgaccgccca      1320
     gggcaagcta ctgcagcagg acacattcta tgtgatcgag ctggatgccg gcatgcagtc      1380
     ccggaccaag gagaggcgtg tgtttctctt tgagcagatt gtcatcttca gtgaactgct      1440
     ccgaaagggg tccctcaccc caggctacat gttcaaaaga agcatcaaga tgaattactt      1500
     ggtcctggaa gacaatgtgg atggtgaccc ctgcaaattt gcactcatga acagggagac      1560
     ttcagaaagg gtcattctac aggctgccaa ctcagacatc cagcaggcct gggtgcagga      1620
     catcaaccaa gtcctagaaa cacagaggga cttcttaaat gcactacagt cacccattga      1680
     gtatcagcgg aaggagagaa gcacagctgt gatccggtcc cagcccccga gggttccaca      1740
     agccagcccc aggccctact cttctggccc ggtgggctca gagaagcccc ccaagggctc      1800
     cagctataac ccgcctctgc cacccctgaa gatatctacc tctaatggca gtccagggtt      1860
     cgactaccat cagcctgggg acaagtttga cgctagcaag aacgacctgg gaggctgcaa      1920
     tgggacatca accatgactg taatcaaaga ttactatgca ctgaaggaga atgaaatctg      1980
     cgtgagccaa ggtgaggtgg tacaggtcct cgccgtcaac cagcagaaca tgtgtctggt      2040
     gtaccagcct gccagcgacc attccccggc agcagagggc tgggtcccag gcagcatcct      2100
     ggcgcccctc gccaaagcca cagcagcggc cgaaagtagt gacgggagca tcaaaaaaga      2160
     accctactga aaccctaggg gagaaaaggc atgccttccg ttgctacatt tggcccacca      2220
     cgggactcac tggactggac ttctatttat attgtatgaa gttactgata tatatatatt      2280
     ttttttttga ttggcaccta gaaatgacct tagcacaaat gccaggcctg gacaggtcag      2340
     agcctgctgc ttctcccaaa agagagggga cttttttttt tttttttttt ttggctgtcc      2400
     acggcaattc cactgtacag attgtaactt tttattttta tttctctcct cccctgtcac      2460
     tttaatatat gttcatggta atttgtaaga tattcctttt ccttattttg attgcaaaaa      2520
     ctcttctgaa cacattcctg tataaagcat tttgcactat ttaaagaaac ccttgtggat      2580
     gaagtcaggt tgtgcaatat ggggagccgc aatgtttagc attgtacctg taatgtaact      2640
     aataatttta aatgtactat tttaaatatg taaaataaat tttcaccatg                 2690
//

If you have problems or comments...

PBIL Back to PBIL home page