(data stored in ACNUC31108 zone)

EMBL: AK090022

ID   AK090022; SV 1; linear; mRNA; HTC; MUS; 4211 BP.
XX
AC   AK090022;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus colon RCB-0549 Cle-H3 cDNA, RIKEN full-length enriched
DE   library, clone:G430064L22 product:weakly similar to PLATELET-ENDOTHELIAL
DE   TETRASPAN ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1) (CD151
DE   ANTIGEN) [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4211
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d53320d454ab6bb42d9b5a4fc6b55c00.
DR   Ensembl-Gn; ENSMUSG00000030351; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031124; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030485; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032501; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080398; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079051; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G430064L22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4211
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G430064L22"
FT                   /cell_line="RCB-0549 Cle-H3"
FT                   /tissue_type="colon"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        269..1030
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
FT                   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1)
FT                   (CD151 ANTIGEN) [Homo sapiens] (SWISSPROT|P48509, evidence:
FT                   FASTY, 59.2%ID, 94%length, match=714)"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="BAC41051.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
FT   regulatory      4187..4192
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4211
FT                   /note="putative"
XX
SQ   Sequence 4211 BP; 978 A; 1174 C; 1128 G; 931 T; 0 other;
     cgggaccgag tgctcagtgt gctctgcttt gggtgggaaa aaaaaaaagc cagctccaaa        60
     caaagagcag ccccggtccc gcccgccccg ggcctgtggg cgcgtccccc agtctgagtg       120
     agaggggcag ccagcagcca ccacgggcca gtgggcaagg agcgcagggt ggagcgggcg       180
     gctgtggcca ggacagccac aatcacagct ccggattccc gatccctcgc tgcatccagc       240
     ctggcggttt tggccgggtc cagccgccat ggcgcactgc aagacagagc aggatgactg       300
     gctgctggcc cacctgaagt acctgctctt catcttcaac ttcttcttct gggtaggtgg       360
     ggcagccgtc atggccgtgg gtatctggac actggtggag aagagcggtt acctcagcat       420
     cttggcctcc agcacgttcg ctgcctctgc ctacatcctc attttcgttg gtggtcttgt       480
     catgacaact ggcttcctgg gctttggggc catcatccgg gagcagaaga gctgcctctc       540
     cacatatttc tgcctgctgc tggtcatctt ccttgtggag ctggtggcag gggtcctggc       600
     acatgtgtac taccagaggc tgagtgacga gctgaagtgg cacctgaaca gcaccctgac       660
     tgagcactac ggacagccca gggccgcaga gatcacagcc tcggtggacc ggctgcagca       720
     ggacttcaaa tgctgtggca gtaacagctc agccgactgg cagcacagcg cgtacatctt       780
     gtctcaggaa gccctgggtc gccaggtgcc cgacagctgc tgcaagacag tggtggcccg       840
     ctgtggtcag cgagcccacc cctccaacat ctacaaggta gagggaggct gtatggccaa       900
     gctggaacag ttcgtggctg accacctgct gctcatggga gcggtgggta ttggggtagc       960
     ctgtcttcag atctgtggga tggtcctcac ctgctgcttg caccgaaggc tccagcaaca      1020
     attttattaa aggacaccca tgtaccctgc tgactggccc acccaaggga ccacatctcc      1080
     acttcctgaa ccaggcctgc aaagtcatcg ctggggctgt ggactcgctc caccctatgc      1140
     agaggccacc aaatgtctgt ggttgtggtt cctgtgcatc ccgactggca ggggcctcag      1200
     ctaactcctc cattcctaag tactcagcca ctgccaaaat ccttgccaag ggatgatcct      1260
     ggccagaggc agccagagcc cctttgccag gcactgggac gctgtggact acaggggggc      1320
     cagagctcat ctccctctga tccatctcag tgtctgagtc tggaatagaa ggccgtcgga      1380
     tggtccctct gagagtccta tagggcttgg cgtgtgattc ccactggcat gtggccccag      1440
     gctggctctc ctttgggaaa accagcactt tgggcagacc aggttagctc agccttttcc      1500
     aaaacctggc tggtttttca atctctccac agaatagctg gccaagacct tcctgtaagg      1560
     tatagggcag aagtgatcaa aggtggggca tcttaaggta gctgttgaag ccaacagcac      1620
     agggcactaa ggaagcaggt tggtcacaac acctaggaaa gtcacacgat ggtcacaatc      1680
     cccagcctct ggtcctgttc ccaggcttga cttccaaaat gtcaggctta aaatgttagt      1740
     gaatgtaaaa ctatctcctc gaccaggtgg ggggcacacc acagtctcag ctgctgagga      1800
     gaggatgcga cgctacgggg aaggaggaac tctgcctgca ccccatctcc tggtgccctt      1860
     gtgacctcac tgtttctctt ccatgcattc tccacttcct tgtccactgt gctggagtag      1920
     atgccggccc ttccttcgct cctctcttta gtcacggaat gacacaggag attcaaggag      1980
     aactcatgtg ttaaaagaca cggaaagaaa attctagaaa aattaaaggt tgatagtagg      2040
     tatcatagac aaccataggg acccccctgt gattattatt actgtaggca gctttgcaca      2100
     ccagggctcc actcctagct tcagtcttcc ctgcttgggt cctgctcatc tctctacaat      2160
     aacaaacctc agttccgaca tgaaccagca gcagcagcaa aaagtgtcca actggttgtc      2220
     tacctggctc agttctcact gtggtgaccc cagatcctgc tgatctgggt caatggttgg      2280
     agagagatga gctcccaccc acacatgggt ggactaaggg ccactggttg cagtcaccag      2340
     cacaggtgga attccactct cagggcagga agtagctgtg tgcacagagg gaacatcagg      2400
     ctctcaggtc agacagcctc ctacacactg gcgttctcca ggggctactc ggagcctgga      2460
     ctggcttata ttattcacct gaaggaccaa cactaagaag aagacactca ctccccaaaa      2520
     tcccagacta cactacatat gggctcagag aaaaacctca gcttcctcca ccttcccagg      2580
     attcacgcag atactcagac tggctgtggt tccgaagctt gtagatggag gatggagaag      2640
     aaaagtggtg gggcccaggt aatgttctcc ccaaaaaggc actgagggag gtgatagtgt      2700
     gcaaaggaat actgtggcct caggcatctg ctttggtagg ctcatcaggg agatgaggtc      2760
     agaggtgata agcagccact gttggtacag acttgatgca gaggtagtcc aggagagcat      2820
     gaggcatcca ctcagtcaga gccacagagt gagcagacag ccccaaatgt gactaccttg      2880
     accatacatc agccttggtg acaagatggg gtgagaggac atgaagcaca tagtaggcca      2940
     ggttcgttcc agcagcttcg aaggctggag ccaagtctgt agtgaggtgt ccccaacagt      3000
     ttcatgccag agtatttcta cctatttccc actcagggac gggccctgtt ccgaggttat      3060
     cggtctggat ttcttagaga aagggaagga cacacctgta gaatgtcacc ctcagtcctg      3120
     ggtcagcaca aaacatactg gggtcccatg ccaggccctg aacttggtgt agctcaagcc      3180
     agtggaccct cattctaagc atataagtga gccaccattc cctaaactca aagtggccac      3240
     ctcaaaaaca cagcccaccc ctaaatcccc cagtgaccag tattggggaa caaggatgga      3300
     ccttagtcta tgacatcaga tggggtgtct ccatgcattc gtccctttcc ctccccaaca      3360
     gtgcatcccc accctcaccc catagcacca tgggcatgta tatattcttc actatgctat      3420
     tcatagtgac accaacggga tgtgctatag ctccccattc tgttgatgaa gaaactaagg      3480
     cttggacaag ctggacatca gtggtgattg ctgttgccat ggccccagtc aggtggacct      3540
     aaagaaatct tgtctgggtg cctctcctcc ccagcaccag ctgccacagc tgccagggag      3600
     gtattcagga gcagagtgtc ctacgtggtg tggccaagta gtggcagcct tgacacctcc      3660
     caggttggat gggagcatcc tgcatggccg atcccaacag ctttctgtta aagcagacac      3720
     ctgtctcatt tcggaacgac aaccaggtcc tctggagcag ctaagaaggc cagggctcat      3780
     aggaatggcc cggagcacac tctggggtcc ttcagagcca tgatagtgag aacagggact      3840
     gtcttagaga tcactctcca taaagatggg agtcacacca tgtggggatc acactgtatc      3900
     cactcagagt cacccaggta tggaggcgcc ctggatgctg atgctgagac tcccctcagg      3960
     ccaggctctc ctctaccttc ttgcccagct cccaagctcc tattctgatt atttgttgtt      4020
     tctgagtgga cacaaggtga cttttgtcct gagtgccttc acccttcaca tggccatagg      4080
     ggctcagctc ctaaagatgc cggatgtggg ggtatgcaca gcaggccagt gtgatgagcc      4140
     actttgaact cagaatctgc ctctctggac agcttccaag gttttgaata aatggatcag      4200
     ttagaacctg c                                                           4211
//

If you have problems or comments...

PBIL Back to PBIL home page