(data stored in ACNUC8465 zone)

EMBL: AK093838

ID   AK093838; SV 1; linear; mRNA; STD; HUM; 2336 BP.
XX
AC   AK093838;
XX
DT   16-JUL-2002 (Rel. 72, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens cDNA FLJ36519 fis, clone TRACH2002092, highly similar to Dual
DE   specificity mitogen-activated proteinkinase kinase 3 (EC 2.7.12.2).
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2336
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (04-JUL-2002) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Oshima A., Takahashi-Fujii A., Tanase T., Imose N., Takeuchi K., Arita M.,
RA   Musashino K., Yuuki H., Hara H., Sugiyama T., Irie R., Otsuki T., Sato H.,
RA   Ota T., Wakamatsu A., Ishii S., Yamamoto J., Isono Y., Kawai-Hio Y.,
RA   Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K., Nakamura Y.,
RA   Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Murakawa K., Kanehori K.,
RA   Sugiyama A., Kawakami B., Suzuki Y., Sugano S., Nagahari K., Masuho Y.,
RA   Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 061374b6360560eb624491a8902e0720.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2336
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TRACH2"
FT                   /clone="TRACH2002092"
FT                   /tissue_type="trachea"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        397..1353
FT                   /codon_start=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   proteinkinase kinase 3 (EC 2.7.12.2)"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="H-InvDB:HIT000018704.20"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="BAG52769.1"
FT                   /translation="MSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGA
FT                   YGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFRE
FT                   GDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVK
FT                   PSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDV
FT                   WSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNP
FT                   AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS"
XX
SQ   Sequence 2336 BP; 458 A; 715 C; 661 G; 502 T; 0 other;
     ggactcgtcc ttgctgcagt cgccgccgca gtcctcgccg cagtcgccgc cgccgccgcc        60
     gccgccgccg ctgctcctcc gcctggcctg ggccgtctgc ccgcagccat gagcgtgctc       120
     ggccccggtg gagcccgcag tcctctagat tagtctccac cgccgtccag gacccacttg       180
     cagcatggag tcgcccgcct cgagccagcc cgccagcatg ccccagtcca aagagaggct       240
     ggtcatatcc atggtgacca tttatgggcc acaacaggtc cccatctgcg cagtgaaccc       300
     tgtgctgagc accttgcaga cgtgatcttg cttcgtcctg cagcactgtg cggggcagga       360
     aaatccaaga ggaagaagga tctacggata tcctgcatgt ccaagccacc cgcacccaac       420
     cccacacccc cccggaacct ggactcccgg accttcatca ccattggaga cagaaacttt       480
     gaggtggagg ctgatgactt ggtgaccatc tcagaactgg gccgtggagc ctatggggtg       540
     gtagagaagg tgcggcacgc ccagagcggc accatcatgg ccgtgaagcg gatccgggcc       600
     accgtgaact cacaggagca gaagcggctg ctcatggacc tggacatcaa catgcgcacg       660
     gtcgactgct tctacactgt caccttctac ggggcactat tcagagaggg agacgtgtgg       720
     atctgcatgg agctcatgga cacatccttg gacaagttct accggaaggt gctggataaa       780
     aacatgacaa ttccagagga catccttggg gagattgctg tgtctatcgt gcgggccctg       840
     gagcatctgc acagcaagct gtcggtgatc cacagagatg tgaagccctc caatgtcctt       900
     atcaacaagg agggccatgt gaagatgtgt gactttggca tcagtggcta cttggtggac       960
     tctgtggcca agacgatgga tgccggctgc aagccctaca tggcccctga gaggatcaac      1020
     ccagagctga accagaaggg ctacaatgtc aagtccgacg tctggagcct gggcatcacc      1080
     atgattgaga tggccatcct gcggttccct tacgagtcct gggggacccc gttccagcag      1140
     ctgaagcagg tggtggagga gccgtccccc cagctcccag ccgaccgttt ctcccccgag      1200
     tttgtggact tcactgctca gtgcctgagg aagaaccccg cagagcgtat gagctacctg      1260
     gagctgatgg agcacccctt cttcaccttg cacaaaacca agaagacgga cattgctgcc      1320
     ttcgtgaagg agatcctggg agaagactca taggggctgg gcctcggacc ccactccggc      1380
     cctccagagc cccacagccc catctgcggg ggcagtgctc acccacacca taagctactg      1440
     ccatcctggc ccagggcatc tgggaggaac cgagggggct gctcccacct ggctctgtgg      1500
     cgagccattt gtcccaagtg ccaaagaagc agaccattgg ggctcccagc caggcccttg      1560
     tcggccccac cagtgcctct ccctgctgct cctaggaccc gtctccagct gctgagatcc      1620
     tggactgagg gggcctggat gccccctgtg gatgctgctg cccctgcaca gcaggctgcc      1680
     agtgcctggg tggatgggcc accgccttgc ccagcctgga tgccatccaa gttgtatatt      1740
     tttttaatct ctcgactgaa tggactttgc acactttggc ccagggtggc cacacctcta      1800
     tcccggcttt ggtgcggggt acacaagagg ggatgagttg tgtgaatacc ccaagactcc      1860
     catgagggag atgccatgag ccgcccaagg ccttcccctg gcactggcaa acagggcctc      1920
     tgcggagcac actggctcac ccagtcctgc ccgccaccgt tatcggtgtc attcaccttt      1980
     cgtgtttttt ttaatttatc ctctgttgat tttttctttt gctctatggg tttggcttgt      2040
     ttttcttgca tggtttggag ctgatcgctt ctcccccacc ccctagggta ccagcaggca      2100
     gagccttgcc ctctgctcag gctggggtcc agtgggaggg gcccaagatc tctgctcaga      2160
     gaagtgcagg gggagccttc cagctcactc tccctgagga ctggcttgac aggggctatg      2220
     ggtttgcttt ggtgttgttt ttaaaaaaag aaaatatatt tttttgaaaa aacgactgcc      2280
     catcccgggt cctttccctg atgggttggg gcagttacct ggttgctgtt ttaatt          2336
//

If you have problems or comments...

PBIL Back to PBIL home page