(data stored in ACNUC24361 zone)

EMBL: AK095261

ID   AK095261; SV 1; linear; mRNA; STD; HUM; 3551 BP.
XX
AC   AK095261;
XX
DT   16-JUL-2002 (Rel. 72, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens cDNA FLJ37942 fis, clone CTONG2008595, highly similar to Zinc
DE   finger protein 323.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3551
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (04-JUL-2002) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Tanigami A., Fujiwara T., Shibahara T., Goto Y., Hirao M., Shimizu F.,
RA   Wakebe H., Ono T., Hishigaki H., Watanabe T., Ozaki K., Sugiyama T.,
RA   Irie R., Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K.,
RA   Nakamura Y., Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Murakawa K.,
RA   Kanehori K., Takahashi-Fujii A., Oshima A., Sugiyama A., Kawakami B.,
RA   Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 1ccb5383d370981413525b6b46712b9a.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3551
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="CTONG2"
FT                   /clone="CTONG2008595"
FT                   /tissue_type="tongue, tumor tissue"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        905..2125
FT                   /codon_start=1
FT                   /note="highly similar to Zinc finger protein 323"
FT                   /db_xref="GOA:B3KTA4"
FT                   /db_xref="H-InvDB:HIT000020116.20"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:B3KTA4"
FT                   /protein_id="BAG53016.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQESPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSRLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
XX
SQ   Sequence 3551 BP; 1061 A; 759 C; 802 G; 929 T; 0 other;
     attgctgggc aactaggtcc cgccggagcg ttccagctca aagattacct gctgcagtca        60
     ggcagaaatg taaagtcttt cctgtttgat tgggaactga cccaggtgcc gggcttgggg       120
     ggacaccgga caaccaaagg caatatgtgg actcggcaag ccactggtcc ctaaacctga       180
     ataagtttcc gggcagagct gcatttattg acggttatga aagctgattt agaagcagca       240
     acgcagcctc ttgcctggaa ttgggatgat gcggctgaaa ccaccttcct ggcagccaaa       300
     caggctattc agcaggcaca agccctatgg gtagctgatc ggggcaccca tttaaacttg       360
     atgtgcatgt gaccagatag ttttgactgg ggcttatggc atcacacaga gctctttaga       420
     atgccagtag acttttggtc ccaactttgg aagggagctg agctccagta ttcctcgaca       480
     gagaagcagt tactaactgc atatgctgcc ctttagactc gtgacagcct ggcaggatgg       540
     gctacagtcg tcgcgcgcat gacttacccc atagcaggcc ccgagtgttc tttcaactac       600
     ctgccaccca tccaacaact cccctcggac ctcagtatgg gctggaacct gacacttggc       660
     atgacagtgc agaccccagg catccaaacc atgacagttc catcagctct ccaaatgaga       720
     ctttgggatt ccagaagaca gaggtttgag tgtaaaacac aaaataacaa aaccacaaca       780
     aaaacaactc tgtattctcg tccccaccat taccatctct cctttgtgat gtcaaagaga       840
     ccagaggaag tggacagact cggggaagaa tagccagagt aagccttcca aattaacccc       900
     aggaatggct tcaacagagg aacagtacga tcttaagatt gtgaaagtgg aggaagaccc       960
     tatctgggac caagaaaccc accttcgagg gaacaacttt tctggccaag aagcctcccg      1020
     acaacttttt aggcagtttt gttaccaaga gtctcctggt ccccgagaag ctctgagccg      1080
     gctccgagaa ctctgtcatc agtggctaag gccagaaatc cacaccaaag agcaaatctt      1140
     ggagctgctg gtgctggagc aattcctgac tatcctgcct gaggagctcc aggcctgggt      1200
     gcgggagcac catccggaga gtggggagga ggctgtggct gtagttgaag atctggaaca      1260
     agagcttagt gagccaggga accaggctcc agaccatgaa catggacatt ctgaagtgct      1320
     cttggaggat gtggaacatc tgaaggtcaa gcaggaacca acagacatac agcttcagcc      1380
     tatggtgaca cagctcagat atgaatcttt ttgcctccac caatttcaag aacaagatgg      1440
     tgaaagtata cctgagaacc aggagttggc atcaaagcaa gaaatcttaa aagaaatgga      1500
     acatttgggg gatagcagac tccaaagaga tgtatctttg gattctaagt acagagaaac      1560
     ttgtaaacga gacagcaagg cagaaaagca gcaggcacat tccactggag agagacgcca      1620
     caggtgcaat gaatgtggga aaagcttcac taagagttca gtactcattg agcaccagag      1680
     aatccacact ggggagaagc catatgaatg tgaagaatgt gggaaggcct tcagccggag      1740
     gtcaagcctg aatgaacatc ggcggagcca cactggagag aaaccctatc aatgtaagga      1800
     gtgtgggaaa gccttcagtg ccagcaatgg cctcactcga cacagaagaa tccacacagg      1860
     ggaaaaacca tatgaatgca aagtgtgtgg gaaggctttc ctcctcagct catgccttgt      1920
     tcagcatcag aggatacaca ctggagagaa gcgctatcag tgtcgtgagt gtggcaaagc      1980
     cttcattcag aatgcagggc ttttccagca tctccgagtc cacactggtg agaaacccta      2040
     tcagtgcagt cagtgcagta aactctttag taagcggaca cttcttaaga aacatcagaa      2100
     aatccacact ggagagagac cataagggtg atgagtttgg gaaagccttc agtcatcatt      2160
     gcaaccttat taggcatttt agaatccata ctgttccagc agaactggac taattctgtg      2220
     gaccctcaga cccctaaatg gggccgtctt ggaaagtaag attttcaagt ggcttattct      2280
     gttcttataa aatttatttt gtattgcatt gaaccacttg tctacaaacc aggtgttggt      2340
     gtctcctgtg tggatgactg tgattgtagg gggttgctgg gtggccttct tattccctag      2400
     cctttggtcc atttcttatg atttccttta aaggcaccaa atcttatctg gaaataaatt      2460
     gttatggagg ggctgttttt gagcaatact gcatattgaa caattctaaa agaccagtat      2520
     ctatgtatac ttttaaaaaa aagatttgct aagatcaaag gatattcaga ggtgcatctt      2580
     tttctgtaag agtgacattt taaacaaatg taaggttttg gggaataaga atcgtccaca      2640
     ttcccacagg aaatcattgc tatggtctcc cctaggaatg tgatagatag cttctataat      2700
     tatgcagcat tatccatagt atgaaacctg tagttttaat ggtttagaaa tctatgtctc      2760
     atttcatatc taactcatgt ttttgatacg aatcaatata tatgttgata tcatgagtta      2820
     atatgagttt gacatgaatc atcaacatag tatatacata tcaacataac tatgttgatg      2880
     attcatatca aattctcaat gcaggtcatt actgtaagtt ttccattttt gttacaaata      2940
     ataagtaaga tgatacttta aaatctctgt tcttcacaag gtacctcttt aattcatagc      3000
     cttttatgtc agcattattc ttcttttggg ggttggtcag caactttgag tgccattgca      3060
     agcagcatca tttaagtagt tttataaaga aaagaagtct gatatcctgg gcagcttgct      3120
     gcttactggg gagaccagca tgcttagaca cttattgcca gggttaaaca tatgctctgg      3180
     caccaagttc aaatctttcc tccccatttg tgagctgtgg gactttaggc aagttatcta      3240
     aatgctgcta tgctatagtc tccccacctg taaaacagag gatgatacca ataccttcct      3300
     catagggtac ataagattaa ataaatacaa acttgtactt aaaatgtagc tctcaataaa      3360
     tgtgcattat gatttacata cgaaataata gcatttaaca aatgtaggta gaattttaag      3420
     tatcatgtta aaattaggat acgaaatgcc tctgctgaca ttcttgttac tcttttctcc      3480
     acagtcaaaa cctgaatcag aatatttcaa aagagaggaa ataaaagttc agcttaaaac      3540
     tgttctgccc t                                                           3551
//

If you have problems or comments...

PBIL Back to PBIL home page