(data stored in ACNUC24361 zone)

EMBL: AK096552

ID   AK096552; SV 1; linear; mRNA; STD; HUM; 3309 BP.
XX
AC   AK096552;
XX
DT   16-JUL-2002 (Rel. 72, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ39233 fis, clone OCBBF2007756, highly similar to Zinc
DE   finger protein 95 homolog.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3309
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (04-JUL-2002) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Oshima A., Takahashi-Fujii A., Tanase T., Imose N., Takeuchi K., Arita M.,
RA   Musashino K., Yuuki H., Hara H., Sugiyama T., Irie R., Otsuki T., Sato H.,
RA   Ota T., Wakamatsu A., Ishii S., Yamamoto J., Isono Y., Kawai-Hio Y.,
RA   Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K., Nakamura Y.,
RA   Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Murakawa K., Kanehori K.,
RA   Sugiyama A., Kawakami B., Suzuki Y., Sugano S., Nagahari K., Masuho Y.,
RA   Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; e21cdb35362904c0a646bd65a36f42cf.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3309
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="OCBBF2"
FT                   /clone="OCBBF2007756"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        790..3090
FT                   /codon_start=1
FT                   /note="highly similar to Zinc finger protein 95 homolog"
FT                   /db_xref="GOA:B3KU58"
FT                   /db_xref="H-InvDB:HIT000021407.18"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:B3KU58"
FT                   /protein_id="BAG53320.1"
FT                   /translation="MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPT
FT                   FETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPE
FT                   EFQPWVREHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPH
FT                   PLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVAD
FT                   VAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHWV
FT                   APEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQST
FT                   HGERGHRCSDCGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGE
FT                   KPYKCQVCGKAFRVSSHLVQHHSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQ
FT                   RCSDKRSKNTKLSVKKKISEYSEADMELSGKTQRNVSQVQEFGEGCEFQGKLDRKQGIP
FT                   MKEILGQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKP
FT                   FRCEECGKSYNQRVHLTQHQRVHTGEKPYSCPLCGKAFRVRSHLVQHQSVHSGERPFKC
FT                   NECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGIC
FT                   EEAYSWNLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQHYRTHTAEKPYQCDICRVV
FT                   IYRMSFSLHCSWD"
XX
SQ   Sequence 3309 BP; 871 A; 831 C; 903 G; 704 T; 0 other;
     ttactaagag atggggtctc actatgttgc ccaggctgga gtgcaatggt gcgatcccgg        60
     ctcactgcat cctcagcctc ccgggtccga gtgattctcc tgcctcagcc tcccgagtgg       120
     ctgggattac aggctcgcgc caccacgccc agctaagttt ttgtgttttt agtagagaca       180
     gggtttcacc atgttggcca ggctggtctt gaactcctgg cctcaggtga tccacccacc       240
     tcggcctccc aaagtgctgg cattacaggt gtgagtcacc gagcccggcc aagggagggt       300
     atttctaata gacaggggtc tcgctatgtt gcccgagctg gtctcgaact cttgggctca       360
     agcgatcctg cttcttcagc ctgtccacta gctaggctta caagcgtggg accccgcgcc       420
     tggctgaaga gaggtatcat taaggacgag acccccttgg ccagggaagc cctgcgtaag       480
     caacgcccct ctcttcaaag gatgccccgc tccctccgcc cactcccagc cttccagcct       540
     tggctcccga ggacacgact ccgggccctg ccaccttctg ataggctcgc gagaccgagg       600
     ctgcaaagag agccgccccc cattggccaa ccggcgagtc ccgcgcgcca cctcctggga       660
     gatgtagttc cgggaacagc tggcccctgc gactcgcggg tgtgacgttg aagatgtcgg       720
     ccttctgagc cgactgcggt ggtcaagagt gtaacacagc cagcctcgaa gacttccctc       780
     tgagttggaa tgataatgac cgaatcccga gaagttatag acttagaccc cccagctgag       840
     acttcccagg agcaggagga ccttttcata gtgaaggtgg aagaagaaga ctgcacctgg       900
     atgcaggagt acaacccgcc aacgtttgag actttttacc agcgcttcag gcacttccag       960
     taccatgagg cttcaggacc ccgggaggct ctcagccaac tccgggtgct ctgctgtgag      1020
     tggctgaggc ccgagctgca cacgaaggag cagatcctgg agctgctggt gctggagcag      1080
     ttcctgacca tcctgcctga agagttccag ccctgggtga gggaacatca ccctgaaagt      1140
     ggagaagagg cggtggccgt gatagaaaat atacagcgag aacttgagga acgcagacag      1200
     cagattgttg cctgccctga tgtgcttcct cggaagatgg caacacctgg agcagtgcag      1260
     gagtcctgca gcccccatcc cctgaccgtg gacacccagc ctgagcaagc gccacagaag      1320
     cctcgtctcc tggaggaaaa tgcccttcct gttctccaag ttccttccct tcccctgaag      1380
     gacagccagg agctgacagc ttcacttctc tcaactgggt cccagaagtt ggtgaaaatt      1440
     gaagaggtgg ctgatgtggc tgtatccttc atcctggagg aatgggggca tttggaccag      1500
     tcccagaagt ccctttatag ggatgacagg aaggagaact atgggagtat tacttccatg      1560
     ggttatgagt ccagggacaa tatggagctc atagtgaagc agatttctga tgactctgaa      1620
     tcacactggg tggcgccaga acacaccgaa aggagcgttc ctcaggatcc agactttgca      1680
     gaagtcagtg accttaaagg catggtacaa aggtggcagg tcaaccccac tgtggggaaa      1740
     tcaaggcaga atccttccca gaaaagggat ctggatgcaa tcacagacat cagccctaag      1800
     caaagcacac atggcgagag agggcacaga tgcagcgatt gtggcaaatt cttcctccaa      1860
     gcctcaaact ttattcagca tcggcgcatc cacactggag aaaaaccgtt taagtgcgga      1920
     gaatgtggga agagctacaa tcagcgggtg cacctcaccc agcaccagcg cgtccacaca      1980
     ggggagaaac cctacaaatg tcaggtgtgc ggaaaggctt tccgggtgag ttcccacctg      2040
     gttcagcacc acagtgtcca cagcggagag aggccctatg gctgcaatga gtgtgggaag      2100
     aacttcggtc gccattcgca tctgatcgaa cacctaaaac gccacttcag ggagaaatcc      2160
     cagagatgca gtgacaaaag aagtaagaac acaaaattaa gtgttaagaa gaaaatttca      2220
     gaatattcag aagcagacat ggaactatct ggaaaaaccc aaagaaatgt ttctcaagtt      2280
     caagagtttg gagaaggctg tgagtttcaa ggcaagctgg atagaaagca gggaattccc      2340
     atgaaagaga tactaggaca accatcttca aagaggatga actacagtga agtcccatat      2400
     gtccacaaaa aatcctccac tggagagaga ccacataaat gtaacgagtg tgggaaaagc      2460
     ttcattcaga gtgcacatct tattcaacat caaagaatac acactgggga gaaaccattc      2520
     aggtgtgagg aatgtgggaa aagctacaac caacgcgtgc acctaactca gcatcagcgc      2580
     gtccacacag gtgagaagcc ctactcctgt cccttatgtg ggaaagcctt cagagtgagg      2640
     tcccaccttg ttcagcatca gagcgtgcac agtggggaga gacccttcaa gtgtaacgaa      2700
     tgtgggaaag gctttgggag gcgttcccac ctggctggac atcttcgact ccactcccga      2760
     gagaaatccc atcagtgtcg tgaatgtggg gaaatctttt ttcagtacgt tagcctaatt      2820
     gaacatcagg tgctccacat gggtcagaaa aatgaaaaaa atggcatctg tgaggaagca      2880
     tatagttgga acttgacagt gattgaagac aagaagattg agttacaaga gcagccttat      2940
     cagtgtgata tctgtggaaa agcctttggt tatagctcag acctcattca gcattacaga      3000
     actcatacag cagagaagcc ctatcaatgt gatatatgta gagtggtgat atacagaatg      3060
     agtttcagtt tgcattgcag ctgggattga aagtaatcag tcatgagcag gcaggcagga      3120
     ggtcctgtta gccctgcctt ccaggaaggt tggggtggga gttttgagtg ggaaagagga      3180
     tgacatgtgt gagagagttc tgagcctgtt tgctagggag agtgagtgag tgctcttggg      3240
     cactgctcag gccgtttctg ctgacttgcc tggcttacaa taaatgccca ataaatattt      3300
     gttgaccat                                                              3309
//

If you have problems or comments...

PBIL Back to PBIL home page