(data stored in ACNUC12215 zone)

EMBL: AK098608

ID   AK098608; SV 1; linear; mRNA; STD; HUM; 1609 BP.
XX
AC   AK098608;
XX
DT   16-JUL-2002 (Rel. 72, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens cDNA FLJ25742 fis, clone TST05965.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1609
RA   Sugano S., Suzuki Y.;
RT   ;
RL   Submitted (08-JUL-2002) to the INSDC.
RL   Sumio Sugano, Institute of Medical Science, University of Tokyo, Laboratory
RL   of Genome Structure, Human Genome Center; Shirokane-dai, 4-6-1, Minato-ku,
RL   Tokyo 108-8639, Japan (E-mail:flcdna@ims.u-tokyo.ac.jp, Tel:81-3-5449-5286,
RL   Fax:81-3-5449-5416)
XX
RN   [2]
RA   Oshima A., Takahashi-Fujii A., Tanase T., Imose N., Takeuchi K., Arita M.,
RA   Musashino K., Yuuki H., Hara H., Suzuki Y., Hata H., Nakagawa K.,
RA   Mizuno S., Morinaga M., Kawamura M., Sugiyama T., Irie R., Otsuki T.,
RA   Sato H., Nishikawa T., Sugiyama A., Kawakami B., Nagai K., Isogai T.,
RA   Sugano S.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 548d8203d524221cb8515ef11c0dc37a.
DR   Ensembl-Gn; ENSG00000172967; homo_sapiens.
DR   Ensembl-Tr; ENST00000331428; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction and 5'-end one pass sequencing: Institute of Medical
CC   Science, University of Tokyo, Laboratory of Genome Structure,
CC   Human Genome Center; 3'-end one pass sequencing: RAB; clone
CC   selection for full insert sequencing: RAB and Helix Research
CC   Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1609
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TST"
FT                   /clone="TST05965"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        93..1472
FT                   /codon_start=1
FT                   /db_xref="GOA:Q5GH77"
FT                   /db_xref="H-InvDB:HIT000023438.17"
FT                   /db_xref="HGNC:HGNC:28778"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH77"
FT                   /protein_id="BAC05352.1"
FT                   /translation="METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYC
FT                   GEVAFGLYMFEIYRKANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHI
FT                   LLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAF
FT                   KYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQIS
FT                   NDDTTIKLPLIEFFCVVMWRFLEVISRVVTLALFIASLKLKSLPVLLIIYFVSLLAPWL
FT                   EFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQR
FT                   WGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQY
FT                   LYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCNSCNRVGYFSIRKSMTC
FT                   S"
XX
SQ   Sequence 1609 BP; 486 A; 290 C; 336 G; 497 T; 0 other;
     aaaaattctg atgcagaatg tatcagtgaa actccctccc actgtctctt gtattagcat        60
     caaggaagcg agaaaaaata agcaccctga gaatggagac agtgtttgaa gagatggatg       120
     aagaaagcac aggaggagtt tcatcttcga aagaagaaat agtccttggc cagagactcc       180
     atctaagctt tccttttagc attatcttct caactgttct ctactgtggt gaggttgcct       240
     ttggtttata catgtttgaa atttatcgaa aagctaatga cacattctgg atgtcattta       300
     ccatcagctt tattattgtg ggggcaattt tggatcaaat tatcctgatg tttttcaaca       360
     aagacttgag gagaaataag gctgcattac ttttttggca cattcttctt ttaggaccta       420
     ttgtgaggtg tttgcacacc attagaaatt accacaaatg gttgaaaaat cttaaacagg       480
     agaaggaaga gactcaagtt agcatcacaa agagaaacac gatgctggaa agggagattg       540
     cattctcaat ccgggataat ttcatgcagc agaaggcttt caagtacatg tcagtgattc       600
     aggcttttct cggttctgtt ccacaattaa ttttgcagat gtatatcagt ctcactatac       660
     gagaatggcc tttgaataga gcattgctga tgacattttc cctgttatca gttacttatg       720
     gggccattcg ctgcaatata ctggccatcc agatcagcaa tgatgatact accattaagc       780
     taccgctgat agaattcttc tgtgtcgtga tgtggcgttt tttggaggtt atctcacgtg       840
     tagtgactct ggcattgttc attgcatctc tgaaactgaa gagcctaccc gttttgttaa       900
     tcatatattt tgtatcattg ttggcaccgt ggctggagtt ttggaaaagt ggagctcatc       960
     ttcctggcaa caaagaaaat aattccaata tggtgggtac agtactgatg cttttcttga      1020
     tcacactgct atatgctgcc atcaacttct cctgctggtc agcagtgaaa ctgcagctgt      1080
     cagatgacaa aataattgac gggagacaga ggtggggcca tagaatccta cactacagct      1140
     ttcagttttt agaaaatgtg ataatgatat tggtatttag gttctttgga gggaaaactt      1200
     tgctgaattg ttgtgactca ttaattgccg tgcagctcat cataagctac ctattggcca      1260
     ctggctttat gctcctcttc tatcagtatt tgtacccatg gcagtcaggc aaagtgttgc      1320
     caggacgtac tgaaaatcag ccagaagcac cgtactatta tgtaaacatc gagaaaactg      1380
     aaaagaataa aaataagcag ctgaggaatt actgtaactc ctgcaatagg gttggatatt      1440
     tttcaatcag aaaaagtatg acatgttcat aaaatataca tatatacttt cacagaacaa      1500
     tgagtaaaga tgctgaatgt gacttgttaa gaggctctta aatttaaaaa atatacacag      1560
     caaaatcttg gaagtggctt ctaataaaat tcatttatgt tctcctgtg                  1609
//

If you have problems or comments...

PBIL Back to PBIL home page