(data stored in ACNUC21429 zone)

EMBL: AK100656

ID   AK100656; SV 1; linear; mRNA; STD; PLN; 2052 BP.
XX
AC   AK100656;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:J023111G18, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-2052
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakamura M., Namiki T., Narikawa R.,
RA   Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E., Ohno M.,
RA   Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R., Saitoh H.,
RA   Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K., Satoh K.,
RA   Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y., Sugano S.,
RA   Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y., Tagawa A.,
RA   Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T., Tsunoda Y.,
RA   Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M., Yasunishi A.,
RA   Yazaki J., Yokomizo S., Yoshimura A.;
RT   ;
RL   Submitted (27-AUG-2002) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; 76ff941a71b82eb5abcb2893817b7459.
XX
CC   This clone is one of the 28K full-length cDNA clones from japonica
CC   rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
CC   and Yamamoto,M.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2052
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="J023111G18"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        155..1759
FT                   /note="(RAP Annotation release2) Ubiquitin domain
FT                   containing protein"
FT                   /note="(Rice Genome Annotation Project) ubiquilin-1,
FT                   putative, expressed"
FT                   /note="mapping to R03-TIGRv4S1-000108R (Chr.3: short
FT                   arm=1769950, long arm=1774715, direction=reverse) for TIGR
FT                   Pseudomol ver4"
FT                   /db_xref="GOA:Q10S80"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q10S80"
FT                   /protein_id="BAG94701.1"
FT                   /translation="MSGGDGEEAAAAAAAATLHIRCTNGSKLAVRADLGLSVGAFKAIV
FT                   AESCDVPAPQQRLIYKGRILKDEQTLASYGVETDHTIHMVRGAAPPPASTAPPAANNVT
FT                   PAINATTASNSPAVGFGGLLHGLGGSGSANSGGLGSFGSGLPELSQMQQQLSENPTLMR
FT                   EIMNMPLMQNILNSPDLIRNIIMNNPQMREIVDRNPDLAHVLNDPSILRQTVEAARNPE
FT                   LMREMMRNTDRAMSNIESSPEGFNMLRRMYETVQEPFLNATTMAGEGDRSSNPFSALLG
FT                   NHGSNQARDPAANSPTTTSESTTGSPAPNTNPLPNPWSTTAGAAQGATRPSPVTNARSA
FT                   TAGGLGGLSSTDLGGMLGGGSDTSFLSQVLQNPTMMQMMQNIMSNPQSMNQLLNINPNV
FT                   RNMMESNTQLREMFQNPEFVRQLTSPETLQQLISFQQSLMSQLGQQQAGPERTQSGAGA
FT                   GNTNLNNLMSMFSGLGAGGGLGVPSAPNVPPEELYATQLAQLQEMGFFDTQENIRALIA
FT                   TAGNVHAAVERLLGNIG"
XX
SQ   Sequence 2052 BP; 529 A; 507 C; 528 G; 488 T; 0 other;
     gacaagcccg tgcagacgag acgcgacacg cgacacggga agaggagggg ggaggggaac        60
     acacgccaca ctcctctcgc ccgcatcgca ctcgcaccgc acgcgtcgaa ggatcgggaa       120
     ggcgcagccc cgcgtcggat cgagagctag ggttatgagc ggcggggacg gggaagaggc       180
     agccgccgcg gcggcggccg cgacgctgca catccggtgc accaacggct ccaagctcgc       240
     ggtgcgggcc gacctggggc tcagcgtcgg ggcgttcaag gcgatcgtcg ccgagagctg       300
     cgacgtgccg gcgccgcagc agcggctgat ctacaagggc cggatcttga aggacgagca       360
     aaccctagcc agctacggtg ttgagacgga tcacaccatt cacatggtcc gtggtgctgc       420
     accaccacca gcgtcaaccg cacctcctgc agccaacaat gtaactcctg ccattaatgc       480
     taccactgct tccaattcac cagcagttgg ttttggaggt ttgttgcatg gtcttggggg       540
     ttcaggttct gctaacagtg gagggttggg ctcatttggt tctggccttc cagaactatc       600
     ccagatgcaa caacagctat ccgagaaccc tacgttgatg agagaaataa tgaatatgcc       660
     actcatgcag aatatattga atagccctga tctaattcgc aatataatta tgaacaaccc       720
     ccaaatgcgt gaaattgttg atcgtaatcc agatcttgct catgtcctca atgatccaag       780
     cattctccgc cagactgttg aagcagctag gaatcctgaa cttatgcgag agatgatgcg       840
     gaacacagac agagccatga gcaacattga atcttctcca gaagggttca atatgctccg       900
     ccgcatgtat gaaactgttc aagagccatt tctgaatgca acaacgatgg ctggggaggg       960
     tgatagaagt tcaaacccat tttctgctct cctaggaaat catggatcaa accaagccag      1020
     agatccagct gcaaattcac caacgaccac ctcagaatcc acaacaggtt ctcctgctcc      1080
     aaacactaat ccacttccaa atccctggag cacaactgct ggagctgcac agggagcaac      1140
     aaggccctct ccagttacca atgcaaggag tgccacagct ggtggcctag gagggttaag      1200
     ttctacagat ttgggaggta tgctgggtgg tggctcggat acttccttct tgagtcaggt      1260
     gttgcaaaat cctacaatga tgcaaatgat gcagaacatt atgtcaaatc ctcagtccat      1320
     gaatcagctg cttaatatca acccaaatgt acgtaatatg atggaatcta acactcagtt      1380
     gagggagatg ttccagaacc cagaatttgt tcgccagttg acatctcctg aaactttgca      1440
     gcaattaatc tcattccagc agtccttgat gtcacaactt ggtcaacaac aagctggccc      1500
     agagcgaacc caatcaggtg ctggtgcagg caatactaac ctcaacaatc tgatgagcat      1560
     gttcagtggg ctcggtgctg gtggtggcct aggtgttcct agtgcaccca atgttccacc      1620
     agaagagcta tatgcaacac aactagctca gctccaagaa atgggtttct ttgacacaca      1680
     ggagaacatt cgagctttga ttgctacagc gggaaatgtt catgctgcgg tggagcgact      1740
     tcttgggaat attggctgat agactgttgt gatcgaagat gtcctcgact tgttacctgt      1800
     agctcagatt gtaagattgt ctggttcatt ggttttatac cgtcagattc aaaggcatca      1860
     tctaggtaca tggtttaggt gaataaatga gtcaagtggg ttaacctttc catacatggt      1920
     tgtcatgtcg tgatcgagat attggtgtat tgatggtact ttgggttggt gtatatacat      1980
     attgagctat tggtggttac tgcagtgtac atgaccgttg tttatgttta cttgcctgct      2040
     cttacaacct at                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page