(data stored in ACNUC30630 zone)

EMBL: AK101810

ID   AK101810; SV 1; linear; mRNA; STD; PLN; 1680 BP.
XX
AC   AK101810;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:J033066M17, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-1680
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakamura M., Namiki T., Narikawa R.,
RA   Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E., Ohno M.,
RA   Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R., Saitoh H.,
RA   Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K., Satoh K.,
RA   Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y., Sugano S.,
RA   Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y., Tagawa A.,
RA   Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T., Tsunoda Y.,
RA   Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M., Yasunishi A.,
RA   Yazaki J., Yokomizo S., Yoshimura A.;
RT   ;
RL   Submitted (27-AUG-2002) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; 4fd70b1f2a0b0081e3f6728e11c82ccf.
XX
CC   This clone is one of the 28K full-length cDNA clones from japonica
CC   rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
CC   and Yamamoto,M.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1680
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="J033066M17"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        44..1219
FT                   /note="(RAP Annotation release2) tRNA pseudouridine
FT                   synthase family protein"
FT                   /note="(Rice Genome Annotation Project) pseudouridylate
FT                   synthase, putative, expressed"
FT                   /note="mapping to R12-TIGRv4S1-000238F (Chr.12: short
FT                   arm=4862260, long arm=4873873, direction=forward) for TIGR
FT                   Pseudomol ver4"
FT                   /db_xref="GOA:Q2QWH9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q2QWH9"
FT                   /protein_id="BAG95242.1"
FT                   /translation="MSAATPDSAAAAKRPIDPSHADPSPAAKLQRSSPPDPSPPAEAQG
FT                   DATDGGGEVAGVRSGEMAGARNPQAQRYLVAVEYVGTRFSGSQQQLNQRTVVGVLEEAF
FT                   HKFIGQPVSIFCSSRTDTGVHALSNVCHVDVERISKRKPGEMLPPHEPGVVKRAVNHFL
FT                   QKNEGDIMVTDVRCVAPDFHARYKALERTYHYRLLSGSEPLSVFEKTSAWHIPEDLNVQ
FT                   AMKKACSILVGHHDFSSFRATGCQANSPMRTLDELSVTEVFPSMFFPSSMERSEMESLD
FT                   GHLVYSRTSVVESSGKGSDASSTSEQSRFENGEEFGKRLRHRCFVVTARARSFLYHQVR
FT                   LMVGLLKSVGTGDLTTEDVERILNLKAVTAAPPMAPACGLYLANVKYDLSV"
XX
SQ   Sequence 1680 BP; 425 A; 397 C; 404 G; 454 T; 0 other;
     aagagccctc gcagaaccct cactctctca tgccgcaatc accatgagcg ccgccacccc        60
     cgactccgcc gccgccgcca agcgccccat cgacccctcc cacgccgacc cgtcgccggc       120
     ggcgaagctc cagaggtcgt ccccgccgga tccctcgccg ccggctgagg cgcagggcga       180
     cgccactgac ggcggcggcg aagtggctgg ggtgagaagc ggggagatgg ccggcgcgcg       240
     gaaccctcag gcgcagcggt acctggtcgc cgtggagtac gtcggcaccc ggttctccgg       300
     ctcccagcag cagctcaacc agcgcaccgt cgtcggcgtc ctcgaggagg catttcacaa       360
     attcattggt cagccagtct caatcttctg ttctagtcga acggacacag gtgttcatgc       420
     tttatcaaat gtttgtcatg ttgacgtgga gcggataagt aaaagaaagc ctggtgaaat       480
     gttgccacct catgagcctg gagttgtaaa acgtgcagtg aaccattttc tacagaagaa       540
     tgaaggtgac ataatggtga ctgatgtccg ttgtgttgca ccagacttcc atgctagata       600
     caaagcccta gagcgcacgt accactatcg tttgctttct ggatctgagc cactatcagt       660
     ttttgagaaa acctctgctt ggcacatacc cgaggattta aatgtacagg caatgaagaa       720
     agcgtgcagc atacttgttg ggcatcatga tttcagttca tttcgagcaa ctggatgtca       780
     ggcaaactct cccatgagaa ctttggatga gcttagtgtt acagaagtat ttccttccat       840
     gttttttcct tcaagcatgg agcgatcaga gatggagtca ttagatgggc atcttgttta       900
     ttcaagaacg tcagttgtgg aatcttctgg aaaaggatct gatgcttcta gtacaagtga       960
     gcaatcaaga tttgagaatg gagaagaatt tggaaagagg ctaaggcatc gttgcttcgt      1020
     tgttactgca cgggcacgtt catttcttta ccaccaggta aggttaatgg ttggtcttct      1080
     aaaatctgtt ggtactggag atctaacaac tgaagatgtt gagagaattc tgaatttaaa      1140
     ggcagtgact gcggcacctc ctatggcacc tgcttgtggt ctctaccttg ccaacgtgaa      1200
     atatgacctg agcgtttgaa ggcagatttc tgaaatgacc acaagttatg tcatgttttg      1260
     tctttcagag gcccatgtgt ttgaattatt gaaatactga gtagagaggt ccagacgcac      1320
     cttggaaagg aaaatgcttt ctcatggtcc gaattttgtg caaatctgga aaattttccc      1380
     cgatatttat aagatacttt tgtgcacatg gtggaaggac atgtatttcc atgttctcat      1440
     tagtttcgac tcctatgtat tcagattatc agatgtcaag tcgcataaca ttctctattg      1500
     aatgtatgca caaagttcta gatcctagga caaattaaac tgtatatgta aactagagtg      1560
     gcagctgacc cttccttgat tatgccttat attgtttcat cttcatttca cacagcacat      1620
     acattatgca aactgcattg catggaatac atttcacctt caattcatac atttgatctg      1680
//

If you have problems or comments...

PBIL Back to PBIL home page