(data stored in ACNUC26462 zone)

EMBL: AK107068

ID   AK107068; SV 1; linear; mRNA; STD; PLN; 1881 BP.
XX
AC   AK107068;
XX
DT   19-JUL-2003 (Rel. 76, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:002-121-E08, full insert sequence.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-1881
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakamura M., Namiki T., Narikawa R.,
RA   Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E., Ohno M.,
RA   Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R., Saitoh H.,
RA   Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K., Satoh K.,
RA   Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y., Sugano S.,
RA   Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y., Tagawa A.,
RA   Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T., Tsunoda Y.,
RA   Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M., Yasunishi A.,
RA   Yazaki J., Yokomizo S., Yoshimura A.;
RT   ;
RL   Submitted (27-AUG-2002) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; 84f1a618dd191090747186466853df47.
XX
CC   This clone is one of the 28K full-length cDNA clones from japonica
CC   rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S., Satoh,K.,
CC   Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J.,
CC   Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T.,
CC   Ohneda,E., Yahagi,W., Suzuki,K., Li,C., Ohtsuki,K., Shishiki,T.
CC   and Yamamoto,M.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M., Kobayashi,M.,
CC   Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M., Masuda,H., Miura,J.,
CC   Mizuno,K., Narikawa,R., Niikura,J., Oka,M., Ryu,R., Sugano,S.,
CC   Sugiyama,A., Suzuki,Y., Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S.,
CC   Yoshimura,A., Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences Center
CC   and Genome Science Laboratory in Riken: Adachi,J., Aizawa,K.,
CC   Akimura,T., Arakawa,T., Carninci,P., Fukuda,S., Hanagaki,T.,
CC   Hara,A., Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K.,
CC   Hiraoka,T., Hori,F., Iida,J., Imamura,K., Imotani,K., Ishii,Y.,
CC   Itoh,M., Kagawa,I., Kanagawa,S., Katoh,H., Kawai,J.,
CC   Kishikawa-Hirozane,T., Kojima,Y., Kondo,S., Konno,H., Kouda,M.,
CC   Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M., Osato,N.,
CC   Ota,Y., Saitoh,H., Sakai,C., Sakai,K., Sakazume,N., Sano,H.,
CC   Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T.,
CC   Sogabe,Y., Tagami,M., Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1881
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="002-121-E08"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        125..1525
FT                   /note="(RAP Annotation release2) Similar to CBL-interacting
FT                   serine/threonine-protein kinase 15 (EC 2.7.1.37)
FT                   (Serine/threonine-protein kinase ATPK10) (SOS2-like protein
FT                   kinase PKS3) (SOS-interacting protein 2) (SNF1-related
FT                   kinase 3.1)"
FT                   /note="(Rice Genome Annotation Project) CBL-interacting
FT                   serine/threonine-protein kinase 15, putative, expressed"
FT                   /note="mapping to R05-TIGRv4S1-000296R (Chr.5: short
FT                   arm=6680367, long arm=6682248, direction=reverse) for TIGR
FT                   Pseudomol ver4"
FT                   /db_xref="GOA:Q60EY8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60EY8"
FT                   /protein_id="BAG97933.1"
FT                   /translation="MPEKGTVVMSRYELGRSLGHGTFSKVYQARSLVSGETVAVKVIDK
FT                   EKALRAGAGMVDQIEREVAVMRLVGRHPNVVRLHEVMASRSKIYFVMELVRGGELLARL
FT                   VAGGGRLGEDAARRYFHQLVAAVDFCHSRGVYHRDLKPENLLVDDDGSGGGGNLKVTDF
FT                   GLSALSASRRHDGLLHTTCGTPSYVAPEIIGDKGYDGATADVWSCGVILFLLLAGYLPF
FT                   FDSNLMEMYKKITNGEFKVPDWFTPDARSLISRLLDPNPTTRITIDELVKHPWFKKGHT
FT                   KRPASSNTMKLNEEEKPANAAMNMKPASLNAFDIISLSQGFDLSGMFCCHGHSSRTQDQ
FT                   LFVTGKPATAIVSRLEEIAETEHFTVKKKQKKRQEEDGMAVKLQGWKEGRKGQLAIDAE
FT                   IFEVSPSCYVVEVKKTAGDTLEYQAFCNRDLRPSLNDICWTSPATAASEKNQLPAVSEV
FT                   SPLSSPRN"
XX
SQ   Sequence 1881 BP; 382 A; 541 C; 567 G; 391 T; 0 other;
     tcgtctctca cccattaacg acatgggctc tccacgttca gccatggccg ccgtgaacat        60
     acactaatcc ggccgtcgcc tccaccagct gccggtggcg gcgccgccgg gcgccggtgt       120
     caagatgccg gagaagggca ccgtggtgat gagccggtac gagctcggcc gctcgctggg       180
     gcacggcacg ttctccaagg tgtaccaggc caggagcctc gtgtccggcg agaccgtcgc       240
     cgtgaaggtg atcgacaagg agaaggcgct gcgcgccggc gccggcatgg tcgaccagat       300
     cgagcgcgag gtcgccgtca tgcggctcgt cggccgccac cccaacgtgg tccgcctcca       360
     cgaggtgatg gccagcagga gcaagatcta cttcgtcatg gagctcgtcc gcggcggcga       420
     gctcctcgcc aggctggtcg ccggcggcgg ccgcctcggg gaggacgcgg cgaggaggta       480
     cttccaccag ctcgtcgccg ccgtcgactt ctgccacagc cgcggcgtct accaccgcga       540
     cctcaagccg gagaacctcc tcgtcgacga cgacggcagc ggcggcggcg gcaacctcaa       600
     ggtcaccgac ttcgggctca gcgcgctcag cgcgtcgcgg cggcacgacg gcctcctcca       660
     cacgacgtgc ggcacgccgt cgtacgtcgc gccggagatc atcggcgaca agggctacga       720
     cggggccacc gccgacgtct ggtcctgcgg cgtcatcctc ttcctcctcc tcgccggcta       780
     cctcccgttc ttcgattcca acctcatgga gatgtacaag aagatcacca atggcgagtt       840
     caaggtcccc gactggttca cccccgacgc acgcagcctc atctccagac tcctcgaccc       900
     aaaccctaca actcgcatca ccatcgacga gctcgtcaag catccatggt tcaagaaggg       960
     acacaccaag cggccggcaa gctcgaacac catgaaactc aacgaggagg agaaaccagc      1020
     gaacgccgcc atgaacatga agccggcgag cttgaacgcg ttcgacatca tctcgctctc      1080
     gcagggattc gacctgtcag ggatgttctg ctgccatggc cacagcagca ggacgcagga      1140
     tcagctgttc gtcaccggga agccggcgac ggcgatcgtg tcgaggctgg aggagatcgc      1200
     ggagacggag cacttcacgg tgaagaagaa gcagaagaag aggcaagaag aggacgggat      1260
     ggcggtgaag ctgcaggggt ggaaggaagg gaggaaaggg cagctcgcca ttgacgccga      1320
     gatcttcgag gtttcgccgt cgtgctacgt cgtcgaggtg aagaaaacgg ccggcgacac      1380
     gctggagtac caggcgttct gcaacagaga cctcaggccg tcgctgaacg acatctgctg      1440
     gacctcgccg gcgacagcag cgtcggagaa gaaccagctg ccggcagtgt cggaggtgtc      1500
     gccactgagt agtcctcgga attgatgtga cagattatct aggtgcagtg gcagatattg      1560
     atcatcagat atgtgctgtt tcccttgttg tttcctttgc tttgaattgt tgttttgatt      1620
     ttttttttat tcttgtttgt gtttcataat gatcttgggg gtagtggtct ggtatttcca      1680
     agttcaagat gaatttcaat tattgttttt ttctgttctt ttgttgtgtg gtggactggt      1740
     ggtttagtgt tgattgttgg acataggtga tagaatgtgt tctccttttg cttaaattgc      1800
     atggtccatt tgtaaggtaa attaatggca tcacaccacc ataatatcca atttatgaat      1860
     gttttagaaa tctctttttt t                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page