(data stored in ACNUC8465 zone)

EMBL: AK117136

ID   AK117136; SV 1; linear; mRNA; STD; PLN; 1793 BP.
XX
AC   AK117136;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   14-FEB-2004 (Rel. 78, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At5g40440 mRNA for putative MAP kinase kinase 3
DE   (ATMKK3), complete cds, clone: RAFL16-67-G17.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1793
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (25-NOV-2002) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:mseki@gsc.riken.go.jp, URL:http://pfgweb.gsc.riken.go.jp,
RL   Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Arabidopsis thaliana full-length cDNA";
RL   Unpublished.
XX
DR   MD5; 191e7fa90a16c3eb11040615b037dff5.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously (Seki et al. (1998) Plant
CC   J. 15:707-720; Seki et al. (2002) Science 296:141-145).
CC   cDNA cleaved with BamHI and XhoI was ligated to modified
CC   Lambda FLC-1-E vector (Carninci et al. (2001) Genomics
CC   77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://pfgweb.gsc.riken.go.jp/)
CC   for further details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1793
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL16-67-G17"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        115..1677
FT                   /codon_start=1
FT                   /gene="At5g40440/MPO12_150"
FT                   /product="putative MAP kinase kinase 3 ATMKK3"
FT                   /db_xref="GOA:O80396"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80396"
FT                   /protein_id="BAC41814.1"
FT                   /translation="MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLS
FT                   RSYGVYNFNELGLQKCTSSHVDESESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIP
FT                   NHRILALKKINIFEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYM
FT                   NGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPK
FT                   ITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSLGLALFECGTGEFP
FT                   YIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFIT
FT                   KHEKERVDLATFVQSIFDPTQRLKDLADMLTIHYYSLFDGFDDLWHHAKSLYTETSVFS
FT                   FSGKHNTGSTEIFSALSDIRNTLTGDLPSEKLVHVVEKLHCKPCGSGGVIIRAVGSFIV
FT                   GNQFLICGDGVQAEGLPSFKDLGFDVASRRVGRFQEQFVVESGDLIGKYFLAKQELYIT
FT                   NLD"
XX
SQ   Sequence 1793 BP; 539 A; 323 C; 381 G; 550 T; 0 other;
     tcatcttcca catctcaagg agacacccaa aaagaaaaac caaacctttg aagaacgaaa        60
     agggttatta aaaaagcaac aaactttgag agtaacaaag aaaaagtagt tatcatggcg       120
     gcattggagg agctaaagaa gaagctgtct ccattgtttg atgctgagaa gggtttttct       180
     tcatcttcat ctttggatcc aaacgattca tatttattat ctgatggtgg gactgtgaat       240
     ttacttagta gatcatatgg agtttataat tttaacgagc tcgggttaca aaaatgtaca       300
     tcttctcatg tggatgagtc tgaaagttcc gagacgacgt atcaatgtgc ttctcacgaa       360
     atgcgggttt ttggagctat aggaagcgga gctagcagcg ttgttcaacg agctattcat       420
     atccctaatc atagaatttt agcgttgaag aagattaata tctttgaaag ggagaaaagg       480
     cagcaattgc ttacagagat acggacattg tgtgaagctc cttgtcatga aggacttgtg       540
     gattttcacg gagcgtttta tagtccagac tcgggacaaa tcagcatagc tcttgaatat       600
     atgaatggag gatctcttgc tgatatttta aaagtaacaa agaagatacc tgagccggtt       660
     ctttcatcat tgttccacaa acttttgcaa ggattgagct acttgcatgg agtgagacat       720
     cttgttcata gagacattaa acctgctaat ttgcttataa atctcaaagg ggaaccgaag       780
     ataaccgatt ttggcataag tgctggcctt gagaattcaa tggctatgtg tgctactttt       840
     gttggaactg tcacctacat gtcaccagag aggataagga atgacagtta ttcttatcca       900
     gctgatatat ggagccttgg tctcgctctt tttgaatgcg gcactggaga gtttccgtat       960
     atagctaatg aagggcctgt taatcttatg ttgcagatat tggatgatcc ttcaccaaca      1020
     ccaccaaaac aagaattctc accagagttc tgttccttca ttgatgcttg cctccagaag      1080
     gatccagatg ctcgaccaac agctgaccag ctcttgtcac acccttttat tacaaaacac      1140
     gagaaggaaa gagtagattt ggcgactttt gttcaaagca tctttgatcc aactcagaga      1200
     ttgaaagatt tagctgatat gctcaccata cattattact ccctctttga tggatttgat      1260
     gatctttggc accacgcaaa atcgctctac actgaaactt cagttttcag tttctctggg      1320
     aaacataaca caggatcaac tgaaatcttc tcagcattat cagacattcg taacacatta      1380
     acaggagatt taccgagtga gaaacttgtt catgtcgttg agaagcttca ttgcaaacct      1440
     tgcggcagtg gtggagtcat aattcgtgct gttggatcgt ttattgttgg aaatcagttt      1500
     ctgatctgtg gtgatggagt ccaagcagaa gggcttccga gtttcaaaga tcttggcttc      1560
     gatgtcgcaa gtagacgtgt tggccgattt caagaacagt ttgttgttga atctggtgat      1620
     cttattggaa agtattttct tgctaagcaa gagctttata ttacaaactt agattagata      1680
     aacacacatg agaaaacgtt tgttctctac tgtactataa tgtaactatg aacttgttta      1740
     attactaaca tatgtaattg tatttgttta aggttcataa aaagtgccgg aat             1793
//

If you have problems or comments...

PBIL Back to PBIL home page