(data stored in ACNUC13479 zone)

EMBL: AK118010

ID   AK118010; SV 1; linear; mRNA; STD; PLN; 1110 BP.
XX
AC   AK118010;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Arabidopsis thaliana At5g01670 mRNA for putative aldose reductase, complete
DE   cds, clone: RAFL19-21-M03.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1110
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (25-NOV-2002) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:mseki@gsc.riken.go.jp, URL:http://pfgweb.gsc.riken.go.jp,
RL   Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Arabidopsis thaliana full-length cDNA";
RL   Unpublished.
XX
DR   MD5; 1d3dcc0ebc382edde2f970a0a2366158.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously (Seki et al. (1998) Plant
CC   J. 15:707-720; Seki et al. (2002) Science 296:141-145).
CC   cDNA cleaved with BamHI and XhoI was ligated to modified
CC   Lambda FLC-1-E vector (Carninci et al. (2001) Genomics
CC   77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://pfgweb.gsc.riken.go.jp/)
CC   for further details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL19-21-M03"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        27..995
FT                   /codon_start=1
FT                   /gene="At5g01670/F7A7_190"
FT                   /product="putative aldose reductase"
FT                   /db_xref="GOA:Q8GXW0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GXW0"
FT                   /protein_id="BAC42643.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQ
FT                   NTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNI
FT                   GVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEG
FT                   GRDLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPE
FT                   QDFQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED"
FT   misc_difference 470
FT                   /replace="a"
FT                   /note="compared to genomic sequence"
XX
SQ   Sequence 1110 BP; 336 A; 225 C; 294 G; 255 T; 0 other;
     caatagaggc aaggaggaga aagccaatgg cacatgccac gtttacgtcg gaagggcaga        60
     atatggagtc gtttcgactc ttgagtggcc acaaaatccc agccgttgga ctcggcacgt       120
     ggcgatctgg gtctcaagcc gcccacgccg ttgtcactgc aatcgtcgag ggtggctata       180
     ggcacataga tacagcttgg gagtatggtg atcagagaga ggtcggtcaa ggaataaaga       240
     gggcgatgca cgctggcctt gaaaggaggg acctctttgt gacctcgaag ctttggtgca       300
     ctgagttatc tcctgagaga gtgcgtcctg ctctgcaaaa cacccttaaa gagcttcaat       360
     tagagtacct tgatctctac ttgattcact ggcctatccg gctaagagaa ggagccagta       420
     agccaccaaa ggcaggggac gttcttgact ttgacatgga aggagtttgg agagaaatgg       480
     agaatctttc caaggacagt ctcgtcagga atatcggtgt ctgtaacttt acagtcacta       540
     agctcaataa gctgctagga tttgctgaac tgatccctgc cgtttgccag atggaaatgc       600
     atcctggttg gagaaacgat aggatactcg aattctgcaa gaagaatgag atccatgtta       660
     ctgcctattc tccattggga tctcaagaag gcgggagaga tctgatacac gatcagacgg       720
     tggataggat agcgaagaag ctgaataaga caccgggaca gattctagtg aaatggggtt       780
     tgcagagagg aacaagtgtc atccctaagt cattgaatcc agagaggatc aaagagaaca       840
     tcaaagtgtt tgattgggtg atccctgaac aagacttcca agctctcaac agcatcactg       900
     accagaaacg agtgatagac ggtgaggatc ttttcgtcaa caagaccgaa ggtccattcc       960
     gtagtgtggc tgatctatgg gaccatgaag actaaaccga acccgagaat caaacataac      1020
     tatgtaagga atgtgtttgt tgtaacttgt aagatatcaa atgtacattt tctgaaaata      1080
     aaagaaagca gtctcccgta aaaaaaaaat                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page