(data stored in ACNUC13479 zone)

EMBL: AK118600

ID   AK118600; SV 1; linear; mRNA; STD; PLN; 2068 BP.
XX
AC   AK118600;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arabidopsis thaliana At5g01760 mRNA for unknown protein, complete cds,
DE   clone: RAFL19-84-J23.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-2068
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (25-NOV-2002) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:mseki@gsc.riken.go.jp, URL:http://pfgweb.gsc.riken.go.jp,
RL   Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Arabidopsis thaliana full-length cDNA";
RL   Unpublished.
XX
DR   MD5; 03b0e135b3af3aeed32bfd82b02f2e7d.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously (Seki et al. (1998) Plant
CC   J. 15:707-720; Seki et al. (2002) Science 296:141-145).
CC   cDNA cleaved with BamHI and XhoI was ligated to modified
CC   Lambda FLC-1-E vector (Carninci et al. (2001) Genomics
CC   77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://pfgweb.gsc.riken.go.jp/)
CC   for further details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2068
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL19-84-J23"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        42..401
FT                   /codon_start=1
FT                   /gene="At5g01760/T20L15_30"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:F4KAU9"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4KAU9"
FT                   /protein_id="BAC43199.1"
FT                   /translation="MRPSCASSSSSSASPSLRLSSVTVAVDKATSELLRTPDWTIIIAI
FT                   CDSLNSNRWQCKDAIKAVKRRLQHKSSRVQLLTLTLLEAMLKNCGDFVHSHIAEKHLLE
FT                   DMVKLVRKKVLFLLS"
XX
SQ   Sequence 2068 BP; 587 A; 474 C; 436 G; 571 T; 0 other;
     cttgtggaat aaaggcattt tcgacgagaa tttctgtaga gatgaggcct tcttgtgctt        60
     cttcctcctc ctcctctgct tctccttcgt tgaggctatc gtcagtgaca gtggcggtgg       120
     acaaagccac gagcgagctt ctccgcactc ctgattggac catcatcatc gccatctgcg       180
     attctctcaa ttctaatcgc tggcaatgca aagatgccat caaagccgtg aagagaagat       240
     tgcagcacaa gagttctaga gttcaattac tcactttaac gttgttggag gcaatgctga       300
     agaactgcgg tgactttgtg cattctcata tcgctgagaa acatcttctt gaagatatgg       360
     ttaagcttgt caggaaaaag gttctttttc ttttatcctg agctctcttg ttaacttctc       420
     caaggcaccc tcttttttag tttgtggata taataataat aatcttgata tgtgtgagtg       480
     ttgaaaatgt gtgtgaaagg gtgattttga agtaaggaac aaactcttga ttttgttgga       540
     tacatggaat gaagcattca gtggagttgc ttgcaaacac cctcactaca actgggcata       600
     ccaagagctt aaacggtgtg gtgtgaaatt tccacaacgt tcgaaagaag cacccctgat       660
     gcttgaacca ccacctccag tgacacagtc ttcttcctct tcttctatga atttaatgtc       720
     cattggctca tttagaaggc ttgacgaaac tatggctaca gaaattgaga gcttaagctt       780
     atcaagcctt gaatccatga gaaatgtgat ggatcttgtg aatgacatgg ttcaagccgt       840
     taatccttct gataaatcag ccttaaaaga tgagctaata gttgatctag tagagcagtg       900
     cagatctaat cagaagaaac taatccagat gctcactaca actgcgtctg tcttctccac       960
     ctttctctac tacatcttct tcttcttcag ctttacttgt tcttcttacc aataagacat      1020
     ctgttctgcc ttcttcttgc ctgcagggac gaggatgttc tggcacgtgg tctcgagctg      1080
     aatgactctt tgcaggtagt gctcgctaga cacgacgcta ttgcctctgg cgtctctctt      1140
     cctttgttgt tgcaggcccc agagccaaga gagacaagct cttccctcaa gacttgtggt      1200
     gctgctgctc ttgagtctgc tgactctgag tcttcttcat catcatcgag cagtgaaagt      1260
     gaaacagatg aagtggagga tgttaaagat gactttatac agctagccaa aaggcatgct      1320
     ctattaaatg ccctacacag cgatgaagaa gaagaaacat tgcttctagg caacgacaat      1380
     gaaaaaacag cagaagcaga agccaagaca cagtgcaaag atctagcttt gttcgacaca      1440
     acaacaacaa caaccaccaa gtcagagcag gatattattg aacttctcag cctaactctg      1500
     tcaacaactg ctctgccctc cccacaaacg caaccgcaga cgcagcaccc atcgtttttt      1560
     gctgatgata atattcttat gaacagctac gttgtcccct gggcacagtc ccaagaagaa      1620
     ccacaagtcc caaaaatgac tcagtttgct ccatcaggac ctcagtttca gccatggcct      1680
     ctgcagcagc aacaaccgta ttcatacggt tatcctcagc cacaatggag cggtggccaa      1740
     gtaaacagta atgacacaac attctggagc caaggaggca atgagaatat ggtctttgag      1800
     agaaacttgc aagtctcaaa ctcatttcct gctagagcca cgggcacatc cggtgctgct      1860
     actgcggcta cagtggacag gcagccgtag aggccatatg ttcctccata caaattgttt      1920
     gaagatctta acgttttccg gaacacagat gggggcgtta ggagtagcaa ataactatgt      1980
     tgtaattagg atataatact tccaaaagac attcaaattc tattagaaat tgacaaagat      2040
     aactaataag actttcaaag tgaggcag                                         2068
//

If you have problems or comments...

PBIL Back to PBIL home page