(data stored in ACNUC13479 zone)

EMBL: AK118809

ID   AK118809; SV 1; linear; mRNA; STD; PLN; 650 BP.
XX
AC   AK118809;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arabidopsis thaliana At2g18740 mRNA for putative small nuclear
DE   ribonucleoprotein E, complete cds, clone: RAFL21-14-M16.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-650
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   ;
RL   Submitted (25-NOV-2002) to the INSDC.
RL   Motoaki Seki, RIKEN Genomic Sciences Center; 1-7-22 Suehiro-cho,
RL   Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
RL   (E-mail:mseki@gsc.riken.go.jp, URL:http://pfgweb.gsc.riken.go.jp,
RL   Tel:81-45-503-9625, Fax:81-45-503-9586)
XX
RN   [2]
RA   Seki M., Iida K., Satou M., Sakurai T., Akiyama K., Ishida J., Nakajima M.,
RA   Enju A., Kamiya A., Narusaka M., Carninci P., Kawai J., Hayashizaki Y.,
RA   Shinozaki K.;
RT   "Arabidopsis thaliana full-length cDNA";
RL   Unpublished.
XX
DR   MD5; 049042e4ca797b1b98888f62132fae8a.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously (Seki et al. (1998) Plant
CC   J. 15:707-720; Seki et al. (2002) Science 296:141-145).
CC   cDNA cleaved with BamHI and XhoI was ligated to modified
CC   Lambda FLC-1-E vector (Carninci et al. (2001) Genomics
CC   77:79-90) digested with BamHI and SalI.
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://pfgweb.gsc.riken.go.jp/)
CC   for further details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..650
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL21-14-M16"
FT                   /note="common name: thale cress"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        90..356
FT                   /codon_start=1
FT                   /gene="At2g18740"
FT                   /product="putative small nuclear ribonucleoprotein E"
FT                   /db_xref="GOA:Q9ZV45"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV45"
FT                   /protein_id="BAC43399.1"
FT                   /translation="MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITG
FT                   FDEYMNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK"
XX
SQ   Sequence 650 BP; 205 A; 105 C; 136 G; 204 T; 0 other;
     agcagaggga caaacgcttt ttagggtttt agatttcctc tgagagagaa ttttcgaaag        60
     cttgagagag atttccaact acgttagcca tggcgagcac caaagttcaa aggattatga       120
     cccaacctat caacttgatt tttaggtttc ttcaaagtaa agctaggatc cagatttggc       180
     tatttgagca gaaagatttg aggattgaag gaagaatcac tggttttgac gaatacatga       240
     atctagtttt ggatgaggct gaagaagtga gcatcaagaa gaacaccagg aaaccacttg       300
     gaaggatttt actcaaagga gacaacataa ctctgatgat gaacacggga aagtgatgtc       360
     tgtctcaaac aactctcttc gatgaccttc aagcttatgt taaatatctg ttgagttctt       420
     cctcagctta attggtactt gacgatacct tcttttcttc aatgtcgtat aatatattgc       480
     aatgtagtga gtgacaaagg agcttgatcg aatctagtgg attggttggt taaaacttca       540
     aaaaagagat ttggtccctt ttggttaaat ctagtgttat gtaatttggc tgatctttgt       600
     tgcaactttt taacctctgt ttaaatttca aaccttaaaa aagtaaaacc                  650
//

If you have problems or comments...

PBIL Back to PBIL home page