(data stored in ACNUC5340 zone)

EMBL: AK120324

ID   AK120324; SV 1; linear; mRNA; STD; PLN; 633 BP.
XX
AC   AK120324;
XX
DT   25-OCT-2003 (Rel. 77, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Oryza sativa Japonica Group cDNA clone:J013057L24, full insert sequence.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Oryza sativa Japonica Group (Japanese rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-633
RA   Kikuchi S.;
RT   ;
RL   Submitted (31-JAN-2003) to the INSDC.
RL   Contact:Shoshi Kikuchi National Institute of Agrobiological Sciences,
RL   Department of Molecular Genetics, Head of Laboratory of Gene Expression;
RL   2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Carninci P., Doi K.,
RA   Fujimura T., Fukuda S., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayashizaki Y., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Hotta I.,
RA   Iida J., Iida Y., Ikeda R., Imamura K., Imotani K., Ishibiki J., Ishii Y.,
RA   Ishikawa M., Itoh M., Kagawa I., Kanagawa S., Katoh H., Kawagashira N.,
RA   Kawai J., Kawamata M., Kikuchi S., Kishikawa-Hirozane T., Kishimoto N.,
RA   Kobayashi M., Kodama T., Kojima K., Kojima Y., Kondo S., Konno H.,
RA   Kouda M., Koya S., Kurihara C., Kurosaki T., Kusumegi T., Li C., Lu M.,
RA   Masuda H., Matsubara K., Matsuyama T., Miura J., Miyazaki A., Mizuno K.,
RA   Murakami K., Murata M., Nagata T., Nakahama Y., Nakamura M., Namiki T.,
RA   Narikawa R., Niikura J., Nishi K., Nomura K., Numasaki R., Ohneda E.,
RA   Ohno M., Ohtsuki K., Oka M., Ooka H., Osato N., Ota Y., Otomo Y., Ryu R.,
RA   Saitoh H., Sakai C., Sakai K., Sakazume N., Sano H., Sasaki D., Sato K.,
RA   Satoh K., Shibata K., Shinagawa A., Shiraki T., Shishiki T., Sogabe Y.,
RA   Sugano S., Sugiyama A., Suzuki K., Suzuki Y., Tagami M., Tagami-Takeda Y.,
RA   Tagawa A., Takahashi F., Takaku-Akahira S., Tanaka T., Tomaru A., Toya T.,
RA   Tsunoda Y., Ueda M., Waki K., Xie Q., Yahagi W., Yamada H., Yamamoto M.,
RA   Yasunishi A., Yazaki J., Yokomizo S., Yoshimura A.;
RT   "Collection, mapping, and annotation of 28K full-length cDNA clones from
RT   japonica rice";
RL   Unpublished.
XX
RN   [3]
RA   Kikuchi S., Satoh K., Nagata T., Kawagashira N., Doi K., Kishimoto N.,
RA   Yazaki J., Ishikawa M., Yamada H., Ooka H., Hotta I., Kojima K., Namiki T.,
RA   Ohneda E., Yahagi W., Suzuki K., Li C., Ohtsuki K., Shishiki T., Otomo Y.,
RA   Murakami K., Iida Y., Sugano S., Fujimura T., Suzuki Y., Tsunoda Y.,
RA   Kurosaki T., Kodama T., Masuda H., Kobayashi M., Xie Q., Lu M.,
RA   Narikawa R., Sugiyama A., Mizuno K., Yokomizo S., Niikura J., Ikeda R.,
RA   Ishibiki J., Kawamata M., Yoshimura A., Miura J., Kusumegi T., Oka M.,
RA   Ryu R., Ueda M., Matsubara K., Kawai J., Carninci P., Adachi J., Aizawa K.,
RA   Arakawa T., Fukuda S., Hara A., Hashidume W., Hayatsu N., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kondo S., Konno H., Miyazaki A., Osato N.,
RA   Ota Y., Saito R., Sasaki D., Sato K., Shibata K., Shinagawa A., Shiraki T.,
RA   Yoshino M., Hayashizaki Y.;
RT   "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from
RT   japonica Rice";
RL   Science, e1252229 301:376-379(2003).
XX
DR   MD5; 98828e5e6b222ae9f17b8941960108c6.
XX
CC   This clone is one of the 32K full-length cDNA clones from
CC   japonica rice.
CC   URL : http://cdna01.dna.affrc.go.jp/cDNA/
CC   NIAS Rice Full-Length cDNA Project Team: Kikuchi,S.,
CC   Satoh,K., Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N.,
CC   Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H., Hotta,I.,
CC   Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K.,
CC   Li,C., Ohtsuki,K., Shishiki,T., Yamamoto,M. and Nakahama,Y.
CC   FAIS Genome Sequencing & Analysis Group: Otomo,Y., Iida,Y.,
CC   Fujimura,T., Ikeda,R., Ishibiki,J., Kawamata,M.,
CC   Kobayashi,M., Kodama,T., Kurosaki,T., Kusumegi,T., Lu,M.,
CC   Masuda,H., Miura,J., Mizuno,K., Narikawa,R., Niikura,J.,
CC   Oka,M., Ryu,R., Sugano,S., Sugiyama,A., Suzuki,Y.,
CC   Tsunoda,Y., Ueda,M., Xie,Q., Yokomizo,S., Yoshimura,A.,
CC   Matsubara,K. and Murakami,K.
CC   Genome Exploration Research Group in Riken Genomic Sciences
CC   Center and Genome Science Laboratory in Riken: Adachi,J.,
CC   Aizawa,K., Akimura,T., Arakawa,T., Carninci,P., Fukuda,S.,
CC   Hanagaki,T., Hara,A., Hashizume,W., Hayashida,K.,
CC   Hayatsu,N., Hiramoto,K., Hiraoka,T., Hori,F., Iida,J.,
CC   Imamura,K., Imotani,K., Ishii,Y., Itoh,M., Kagawa,I.,
CC   Kanagawa,S., Katoh,H., Kawai,J., Kishikawa-Hirozane,T.,
CC   Kojima,Y., Kondo,S., Konno,H., Kouda,M., Koya,S.,
CC   Kurihara,C., Matsuyama,T., Miyazaki,A., Murata,M.,
CC   Nakamura,M., Nishi,K., Nomura,K., Numasaki,R., Ohno,M.,
CC   Osato,N., Ota,Y., Saitoh,H., Sakai,C., Sakai,K.,
CC   Sakazume,N., Sano,H., Sasaki,D., Sato,K., Shibata,K.,
CC   Shinagawa,A., Shiraki,T., Sogabe,Y., Tagami,M.,
CC   Tagami-Takeda,Y., Tagawa,A., Takahashi,F.,
CC   Takaku-Akahira,S., Tanaka,T., Tomaru,A., Toya,T., Waki,K.,
CC   Yasunishi,A. and Hayashizaki,Y.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..633
FT                   /organism="Oryza sativa Japonica Group"
FT                   /cultivar="Nipponbare"
FT                   /mol_type="mRNA"
FT                   /clone="J013057L24"
FT                   /db_xref="taxon:39947"
FT   CDS_pept        48..470
FT                   /note="(RAP Annotation release2) 60S ribosomal protein L17
FT                   [Oryza sativa (japonica cultivar-group)]"
FT                   /note="(Rice Genome Annotation Project) 60S ribosomal
FT                   protein L23, putative, expressed"
FT                   /note="mapping to R10-TIGRv4S1-000460R (Chr.10: short
FT                   arm=16897984, long arm=16899980, direction=reverse) for
FT                   TIGR Pseudomol ver4"
FT                   /db_xref="GOA:Q9AV77"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AV77"
FT                   /protein_id="BAG99967.1"
FT                   /translation="MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGI
FT                   KGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGV
FT                   IVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV"
XX
SQ   Sequence 633 BP; 129 A; 167 C; 198 G; 139 T; 0 other;
     gcgggtcctc gtctcctcgc gccgccgccg ccgccgcgga cgccgccatg tcgaagcgag        60
     ggaggggtgg gtcggcgggg aacaagttcc ggatgtcgct gggtctgccg gtggcggcga       120
     cggtgaactg cgccgacaac accggcgcca agaacctcta catcatctcc gtgaagggca       180
     tcaaggggag gctcaaccgg ctgccgtcgg cctgcgtcgg cgacatggtc atggccaccg       240
     tcaagaaggg gaagcccgac ctccggaaga aggtcatgcc cgccgtcatc gtccgccagc       300
     gcaagccgtg gcgccgcaag gacggcgtct acatgtactt cgaagacaat gctggggtga       360
     ttgtgaatcc caagggtgag atgaaaggtt ctgctatcac tggacccatt ggtaaggagt       420
     gcgccgacct ctggccaagg attgctagcg cagcaaatgc cattgtctag agcttgtttg       480
     gagtagtagt tttcagttct gtgccggatg tgataatgtg ctccagttct tttttgtttc       540
     caaccaagtt taacctgaac ttgaagcaaa ccttcagtta aattttcagt gcggattgtg       600
     tccttgatga atggaaaatg gcatgtttgc ttg                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page