(data stored in ACNUC8465 zone)

EMBL: AK124398

ID   AK124398; SV 1; linear; mRNA; STD; HUM; 2367 BP.
XX
AC   AK124398;
XX
DT   09-SEP-2003 (Rel. 77, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ42407 fis, clone BGGI12000054, highly similar to
DE   Rho-related GTP-binding protein RhoB precursor.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2367
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (15-JUL-2003) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Oshima A., Takahashi-Fujii A., Tanase T., Imose N., Takeuchi K., Arita M.,
RA   Musashino K., Yuuki H., Hara H., Sugiyama T., Irie R., Otsuki T., Sato H.,
RA   Wakamatsu A., Ishii S., Yamamoto J., Isono Y., Kawai-Hio Y., Saito K.,
RA   Nishikawa T., Kimura K., Yamashita H., Matsuo K., Nakamura Y., Sekine M.,
RA   Kikuchi H., Kanda K., Wagatsuma M., Murakawa K., Kanehori K., Sugiyama A.,
RA   Kawakami B., Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K.,
RA   Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; a0dd18b7b6ead81da9ccd7a980306051.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: Reverse Proteomics Research
CC   Institute, HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2367
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BGGI12"
FT                   /clone="BGGI12000054"
FT                   /cell_line="GI1"
FT                   /cell_type="glioma separated from gliosarcoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        393..983
FT                   /codon_start=1
FT                   /note="highly similar to Rho-related GTP-binding protein
FT                   RhoB precursor"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000044271.15"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="BAG54035.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 2367 BP; 478 A; 684 C; 675 G; 530 T; 0 other;
     atctgccacc gcagtctggt tggagctgtt gtcttgtatg ctcagcgagg cccggagaga        60
     cccgggagag agctaggccg agtccaccgc ccgagtctgc tgcccgagcc cgcgttacgc       120
     acaaagccgc cgatccccgg cctggggtga gcagagcgac caccgcccgg gagcagcgcg       180
     gcgagacgca cggtgcgccc tatgcccccg cgcccccacc gcccccgccg cggcagccga       240
     agcgcagcga gagaacgcgc caccgcgggg cccgggtgca gctagcgacc ctctcgccac       300
     ctgcgcgcag cccgaggtga gcagtgagcg gcgagcggga gggcagcgag gcgttcgcgg       360
     gccccctcct gctgcccggg cccggcccgc tcatggcggc catccgcaag aagctggtgg       420
     tggtgggcga cggcgcgtgt ggcaagacgt gcctgctgat cgtgttcagt aaggacgagt       480
     tccccgaggt gtacgtgccc accgtcttcg agaactatgt ggccgacatt gaggtggacg       540
     gcaagcaggt ggagctggcg ctgtgggaca cggcgggcca ggaggactac gaccgcctgc       600
     ggccgctctc ctacccggac accgacgtca ttctcatgtg cttctcggtg gacagcccgg       660
     actcgctgga gaacatcccc gagaagtggg tccccgaggt gaagcacttc tgtcccaatg       720
     tgcccatcat cctggtggcc aacaaaaaag acctgcgcag cgacgagcat gtccgcacag       780
     agctggcccg catgaagcag gaacccgtgc gcacggatga cggccgcgcc atggccgtgc       840
     gcatccaagc ctacgactac ctcgagtgct ctgccaagac caaggaaggc gtgcgcgagg       900
     tcttcgagac ggccacgcgc gccgcgctgc agaagcgcta cggctcccag aacggctgca       960
     tcaactgctg caaggtgcta tgagggccgc gcccgtcgcg cctgcccctg ccggcacggc      1020
     tccccctcct ggaccagtcc cccgcgagcc cggagaaggg gagacccgtg tcccacaagg      1080
     accccaccgg cctgcctggc atctgtctgc tgacgcctct ggcttgcgcc aggacttggc      1140
     gtgggcaccg ggcgccccca tcccagtgtc tgtgtgcgtc cagctgtgtt gcacaggcct      1200
     gggctcccca ctgagtgcca agggtcccct gagcatgctt ttctgaagag ccgggcctca      1260
     gagtgtgtgg ctgtgtgtct gttcgactcc cctcgcccca ttttcacccc acccccgcct      1320
     ctgatccccg ggggcgagat tggcgcggga gtgtggccgc gccccatcag atgttctccc      1380
     ttcaccagcg ggagcttgat atcccttgtc tgtaacatag accccgggta ctgcgggagg      1440
     ggagggctgc tggggaggat ggggggatgt tatataaata tagatataat tttattttcg      1500
     gagctaagat ggtgttattt aagggtggtg atgggtgagc gctctggccc aggctgggcc      1560
     agactcccgc ccaagcatga acaggacttg accatctttc caacccctgg ggaagacatt      1620
     tgcaactgac ttggggagga cacagcttca gcacagcctc tcctgcgggc cagcccgctg      1680
     cgaaccctcc accagctacc ggagggagga gggaggatgc gctgtggggt tgtttttgcc      1740
     ataagcgaac tttgtgcctg tcctagaagt gaaaattgtt cagtccaaga aactgatgtt      1800
     atttgattta tttaaaggct aaaatttgtt tttttattct ttgcacaatt gtttcattgt      1860
     ttgacactta atgcactcgt catttgcata cgacagtagc attctgacca cacttgtacg      1920
     ctgtaacctc atctacttct gatgttttta aaaaatgact tttaacaagg agagggaaaa      1980
     gaaacccact aaattttgct ttgtttcctt gaagaatgtg gcaacactgt tttgtgattt      2040
     tatttgtgca ggtcatgcac acagttttga taaagggcag taacaagtat tggggcctat      2100
     tttttttttt ttccacaagg cattctctaa agctatgtga aattttctct gcacctctgt      2160
     acagagaata cacctgcccc tgtatatcct tttttcccct cccctccctc ccagtggtac      2220
     ttctactaaa ttgttgtctt gttttttatt ttttaaataa actgacaaat gacaaaatgg      2280
     tgagcttatg atgtttacat aaaagttcta taagctgtgt atacagtttt ttatgtaaaa      2340
     tattaaaaga ctatgatgat gacattt                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page