(data stored in ACNUC31183 zone)

EMBL: AK124640

ID   AK124640; SV 1; linear; mRNA; STD; HUM; 3578 BP.
XX
AC   AK124640;
XX
DT   09-SEP-2003 (Rel. 77, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens cDNA FLJ42649 fis, clone BRACE3027326, moderately similar to
DE   RAP1 GTPase activating protein 1.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3578
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (15-JUL-2003) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Ninomiya K., Wagatsuma M., Kanda K., Kondo H., Yokoi T., Kodaira H.,
RA   Furuya T., Takahashi M., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Sugiyama T., Irie R.,
RA   Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K.,
RA   Nakamura Y., Sekine M., Kikuchi H., Murakawa K., Kanehori K.,
RA   Takahashi-Fujii A., Oshima A., Sugiyama A., Kawakami B., Suzuki Y.,
RA   Sugano S., Nagahari K., Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; f7bbdbe83b1ea17c184708fbbe131256.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: Reverse Proteomics Research
CC   Institute, HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3578
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRACE3"
FT                   /clone="BRACE3027326"
FT                   /tissue_type="cerebellum"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        237..2372
FT                   /codon_start=1
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000044513.15"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="BAC85912.1"
FT                   /translation="MLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLE
FT                   KMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPENVGTP
FT                   TSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLILS
FT                   VKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFNPVLY
FT                   PKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESLAFKEFLDLLGDTITL
FT                   QDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHIGNDI
FT                   VAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGPPLPS
FT                   PPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQAMLG
FT                   LGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSM
FT                   EVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPD
FT                   GGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGEGEAM
FT                   EEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNSPRSN
FT                   LKFRFDKLSHASSGAGH"
XX
SQ   Sequence 3578 BP; 808 A; 1025 C; 1027 G; 718 T; 0 other;
     gcagacagac atcggcacgt atggacggcg cgagccggta ctgcgttccg gaggagccat        60
     ccggcgtcac aggctgtgct ggggaggtgg ggtgaccgtc ctcagaaacc cccgcgggcg       120
     gggcgctgca cacacgtcca cctatagggt gtgtgtgcgt gcgtgaggtg tgcagcccct       180
     gtcaggatct ggcgagagaa gctgaccggg atggaggtca gaggatcgac aagaccatgc       240
     tggcaagtct gaaggtcaag aagcaggagc tggccaacag ctcggatgcg accctcccag       300
     accggccgct ctcccctcct ctcacggcac ctcccaccat gaagtcgtcg gagttctttg       360
     agatgctgga gaaaatgcag gggatcaagc ttgaagagca gaagccggga ccccagaaga       420
     acaaggacga ctatatccca taccccagca tcgacgaggt tgtggagaag ggaggcccgt       480
     accctcaggt catcctgcca cagtttgggg gctattggat cgaggacccg gagaacgtgg       540
     gcaccccaac atcgctgggg agcagcatct gtgaggagga ggaagaggac aacctcagcc       600
     ccaacacatt tggctacaag ctcgagtgca agggtgaagc cagggcctac cggaggcact       660
     tcctggggaa ggatcatcta aacttttact gtaccggcag cagcctgggg aacttgatcc       720
     tgtccgtcaa gtgcgaggaa gcagagggga tcgagtacct ccgggtcatc ctcaggtcca       780
     aactgaagac ggtacatgag cggatcccct tggctggact gagcaagctt cccagtgtcc       840
     ctcagattgc aaaggctttc tgtgatgatg cagtgggact gagattcaat cctgtcctgt       900
     accccaaggc ctcccaaatg attgtgtcct atgatgagca tgaagtcaac aacacattca       960
     aattcggagt catttatcaa aaagccaggc agaccctgga ggaggagcta tttgggaaca      1020
     atgaggagag cctagctttt aaggagttct tggacctgct gggggacacg atcacactgc      1080
     aggatttcaa aggtttccga ggaggcctgg acgtgaccca cggacagaca ggggtggaat      1140
     cagtgtacac aacattccgg gacagggaga tcatgtttca cgtttccaca aagctgccat      1200
     ttaccgacgg agacgcccag cagctccaga gaaagagaca cattggaaat gacatcgtgg      1260
     ccatcatctt ccaagaggaa aacacgccgt ttgtcccaga catgatagcc tccaatttct      1320
     tacatgccta catcgtcgtg caggtcgaga ccccaggcac agagacccca tcctacaagg      1380
     tctctgtcac tgcgcgggaa gatgtgccca cctttggtcc acctctgccc agtccccccg      1440
     ttttccagaa gggcccggaa ttcagggagt ttctgctcac caagctcacc aatgccgaga      1500
     acgcctgctg caagtcggac aagtttgcaa agctggagga ccggaccagg gctgccctcc      1560
     tggacaacct tcacgatgag ctccacgccc acacacaggc catgctggga ctgggcccag      1620
     aggaggacaa gtttgagaat ggaggccacg gggggttcct ggagtctttt aagagggcca      1680
     tccgcgtacg cagccactcc atggagacca tggtgggcgg ccagaagaag tcgcacagtg      1740
     ggggcatccc tggcagcctc agcgggggca tctcccacaa cagcatggag gtcaccaaga      1800
     ccaccttctc gcctccagtg gtggcggcaa cggtgaagaa ccagtcacgg agtcccatca      1860
     agcgacgctc ggggctcttc ccccgcctgc acacgggctc agaaggccag ggcgacagcc      1920
     gggcacgatg tgacagcaca tccagcacac ccaagacccc agatggtgga cactcctctc      1980
     aggagataaa gtctgagacc tcatccaatc ccagctctcc ggaaatctgc cccaacaagg      2040
     agaagccctt catgaagttg aaggaaaacg gccgtgccat ctcccgctcc tcctccagca      2100
     ccagcagcgt cagcagcact gcaggggagg gcgaggccat ggaggagggc gacagtgggg      2160
     gcagccagcc gtccacgacc tcacccttca agcaggaggt gtttgtctac agcccgtccc      2220
     cgagcagcga gagccccagc ctgggggcag ctgccacccc gatcatcatg agccggagtc      2280
     ccacagatgc caaaagcaga aactccccga gatcgaacct gaaattccgc tttgacaagc      2340
     tcagccatgc cagctctggt gcgggtcact aatgtgaaag tggagtcctt cgcctgtcca      2400
     agggaatccc ctcttctgtc ctggaaaagg ctcctgtacc agcagtttgg gagtgccgtc      2460
     cacgaccctg acagtcccag ccctgctgcc ccatggccac gtgcccacag atgtgctgtt      2520
     ggtccaggtg tcccagtctg gccacagccc tgcctccgcc ctcacctaca tgccctccca      2580
     gcccctccca tctctggacg aggcctcctt cctcaggttc ctcctgctcc tgacctccca      2640
     gtgtgatgtc cgggtccttt atcatcctat tcatcctgga gaggaaaagt gtcgggcaaa      2700
     gggggatctg gggggagctc agcagtgact ggggagctgg tctgcctcag agacagagta      2760
     gggggtggga gcagagcctc ggtgagggtc ttggccacag ggcagtgcct tcctgaacgt      2820
     ggcaggcttt actaccagga acgcactcgg tggtggaggc cccatgttcc caggagccaa      2880
     gattcgtagc atccttgagg ccatcctgat aaaattcggc gctattgccc ccgtagctct      2940
     ggagctctaa accgtctatc tgcttctgtg ctgaacgcct ttcccatctg ctgacgtagg      3000
     cccagggctg ccctgcccct gctgccagtg taccgtgagc ggggctccag ccagttcaag      3060
     ctcagagcca gagctggacg ggccagaact gcgctgcaca cttcctggac tgaggcgggg      3120
     actttgggtc ccacccggtt tctcctgatt atggctgctg tggggtgagg ggagggaggg      3180
     gcagccccga ggcagtctct tccctttgag aagatatttt cctgctcctt agcatgcgtg      3240
     cagctctctc ctgttttggg tgttaccctt ggacactcca gctcggggac tgctggcgtg      3300
     tgagtgtgca gattcccctg tgtggtcgaa cctaagaact gtggcttgga agtgatgctc      3360
     catgtgacga cgactttgct ttctttcctc ttagtgagga ggcgattcgt agatcccaac      3420
     tgcctatgta atgtaaataa tgtacattta atttattgct atggtagcac attgtatttg      3480
     ttaatgtaca aaacaaattc taaaaggttg acaaatgtat attttgttgc ttaaatgtgt      3540
     ctttgcagaa attgacaata aataacatat tttgtgtc                              3578
//

If you have problems or comments...

PBIL Back to PBIL home page