(data stored in ACNUC18858 zone)

EMBL: AK131203

ID   AK131203; SV 1; linear; mRNA; STD; HUM; 2064 BP.
XX
AC   AK131203;
XX
DT   10-MAY-2004 (Rel. 79, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens cDNA FLJ16060 fis, clone TESTI2030728, moderately similar to
DE   N-ACETYLLACTOSAMINIDE BETA-1,6-N-ACETYLGLUCOSAMINYLTRANSFERASE (EC
DE   2.4.1.150).
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2064
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Kanehori K., Ishibashi T., Chiba Y., Fujimori K., Hiraoka S., Tanai H.,
RA   Watanabe S., Ishida S., Ono Y., Hotuta T., Watanabe M., Sugiyama T.,
RA   Irie R., Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Matsuo K., Nakamura Y.,
RA   Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Takahashi-Fujii A.,
RA   Oshima A., Sugiyama A., Kawakami B., Suzuki Y., Sugano S., Nagahari K.,
RA   Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 945db2fcf437bd2f83a7d632ad10a879.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2064
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TESTI2"
FT                   /clone="TESTI2030728"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        707..1999
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6ZNI0"
FT                   /db_xref="H-InvDB:HIT000249491.15"
FT                   /db_xref="HGNC:HGNC:16099"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZNI0"
FT                   /protein_id="BAD18395.1"
FT                   /translation="MSQLRATKSGLVVRAVICIFIFLYLRNPTPAESEEEPAQPEVVEC
FT                   GFYPDELCSALFEGKGAAPQIAKFCKTPHKSEIHAHLHTPGNCSRISRGLHFITRPLSA
FT                   EEGDFSLAYIITIHKELAMFVQLLRAIYVPQNVYCIHVDEKAPMKYKTAVQTLVNCFEN
FT                   VFISSKTEKVAYAGFTRLQADINCMKVLVHSKFQWNYVINLCGQDFPIKTNREIIHYIR
FT                   SKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPPHNLTIYFGSAY
FT                   YVLTRKFVEFILTDIHAKDMLQWSKDIRSPEQHYWVTLNRLKDAPGATPNAGWEGNVRA
FT                   IKRKSEEGNVHEGCKGRYVEDICVYGPGDLPWLIQSPSLFANKFEPSTDPLVVTCLERR
FT                   HRLQVLRQAEVPIEPHWHFQQQSHFNMRLNR"
XX
SQ   Sequence 2064 BP; 618 A; 481 C; 455 G; 510 T; 0 other;
     ataagctcca cctcgagttc cattaaggta ttgaatgcac agtctttgtt gggggaagca        60
     tttctttttt tctttaatgg agagtgaagt tggccgcctc gaaggccagg aggactctgc       120
     tcctgtcagg aaagatactc aagctatcat ctgtaaacat gaacaacatt tactgctgga       180
     tggggaatca ccagcgcatg gaagaactct tggtggatgc gttgtctgga gcctgctcac       240
     tccgccacgt tactcagcaa tgctttccct gtttctggat accacgctcc cttctgaacg       300
     atgaagcatg aagcaccacg ctccataaaa gaccctccct ctccccgtgg gagggctcag       360
     gaagctatga gacctgagta tgtactgcct taaatcaaca gcaacagaag gatctggtcc       420
     caaggaaata ctcagagaag caaaagcagc aacttttcaa tctgcaggtc agaaccaaca       480
     ggaataaaac tctccaggga cagatggcaa caaaacctgc caagcaactc tactcaagtg       540
     actgaagcag gcgccgctgc cggggaggaa ccgatgggag agaaaggcca ggctgggccc       600
     tgacaccgcc aggactcccc ctccaggaat cagggggctt ctcctggaag cttaaaggaa       660
     aaaatactta aattatggta ataagaatgc acctggagct caagatatga gccagcttcg       720
     agccacaaag tctggacttg tcgtgagggc agtcatttgc atcttcattt ttctttactt       780
     aaggaatcca actcctgcag aatcagaaga agaacctgcc caaccagaag tagtagaatg       840
     tggcttttac ccagatgaac tgtgttccgc tttatttgaa gggaaagggg cggcccccca       900
     aattgcaaaa ttttgcaaaa cccctcataa atctgaaata catgctcatt tacacacacc       960
     aggaaactgc tccaggattt ctcgggggct gcatttcata accagacccc tgtctgcaga      1020
     agagggcgat ttctctttgg catatattat aactattcat aaggagctgg ccatgtttgt      1080
     gcagcttctc agagctattt atgtacctca aaatgtttat tgtattcatg ttgatgaaaa      1140
     ggccccaatg aagtataaga ctgctgtgca aaccttggtt aactgttttg aaaacgtttt      1200
     tatttcctcc aagacagaga aggtggctta tgctggcttt acaagactac aggcagatat      1260
     taattgtatg aaagttctag tgcattctaa atttcaatgg aactatgtca tcaatctttg      1320
     tggacaggat tttcccatca aaaccaacag agaaatcata cactacatca gaagcaaatg      1380
     gagtgataaa aatattactc ctggagtaat ccaaccattg cacattaaat ccaagacaag      1440
     tcaaagtcat ctcgaattcg ttcctaaagg aagtatctat gcacctccaa ataacagatt      1500
     caaagacaaa ccaccccata acttaaccat ttattttgga agtgcttact atgtacttac      1560
     aaggaagttt gtagagttca tactgactga catccatgca aaagacatgc ttcagtggtc      1620
     caaagacatc cgcagcccag agcaacacta ctgggtgacc ctgaaccgac taaaagatgc      1680
     tccaggtgct acaccaaacg ctggctggga aggaaatgtt cgagccatta agcggaaaag      1740
     tgaggaagga aatgttcatg aaggatgtaa aggccgctac gtcgaagaca tctgcgtata      1800
     cggaccagga gacctgccgt ggctcattca gtcgccttct ctgtttgcca acaaattcga      1860
     accctcgaca gacccgcttg tggttacctg cttagagcgg cggcacagac ttcaagtgct      1920
     gaggcaggca gaagttccta tagagccaca ctggcatttt caacagcaga gtcatttcaa      1980
     tatgagactg aaccgctagg gagtgtttgc tttcttactg gtatcattct gtttccttga      2040
     cttgaaacaa gagaacattg aacc                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page