(data stored in ACNUC8465 zone)

EMBL: AK131544

ID   AK131544; SV 1; linear; mRNA; STD; HUM; 3857 BP.
XX
AC   AK131544;
XX
DT   10-MAY-2004 (Rel. 79, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens cDNA FLJ16780 fis, clone BRTHA2034874, highly similar to Dual
DE   specificity mitogen-activated protein kinase kinase 4 (EC 2.7.12.2).
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3857
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Ota T., Nakagawa S., Senoh A., Mizuguchi H., Inagaki H., Sugiyama T.,
RA   Irie R., Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K.,
RA   Nakamura Y., Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Murakawa K.,
RA   Kanehori K., Takahashi-Fujii A., Oshima A., Sugiyama A., Kawakami B.,
RA   Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 381ff4a7dc187167769b05ec8ee100f2.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: HRI and RAB; annotation: Reverse Proteomics Research
CC   Institute, HRI and RAB.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3857
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA2"
FT                   /clone="BRTHA2034874"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        55..1287
FT                   /codon_start=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   protein kinase kinase 4 (EC 2.7.12.2)"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000249832.14"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="BAG54774.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFC
FT                   EKAQSKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQ
FT                   HWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVV
FT                   MRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLA
FT                   TVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYM
FT                   APERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLS
FT                   NSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQM
FT                   PATPSSPMYVD"
XX
SQ   Sequence 3857 BP; 1133 A; 801 C; 814 G; 1109 T; 0 other;
     agagcttgct gcattgcagc cgccgcggcg ccgctcggct cttcactccc aacaatggcg        60
     gctccgagcc cgagcggcgg cggcggctcc gggggcggca gcggcagcgg caccccaggc       120
     cccgtagggt ccccggcgcc aggccacccg gccgtcagca gcatgcaggg ctttcagata       180
     aacttctgtg aaaaggcaca aagtaaacgc aaagcactga agttgaattt tgcaaatcca       240
     cctttcaaat ctacagcaag gtttactctg aatcccaatc ctacaggagt tcaaaaccca       300
     cacatagaga gactgagaac acacagcatt gagtcatcag gaaaactgaa gatctcccct       360
     gaacaacact gggatttcac tgcagaggac ttgaaagacc ttggagaaat tggacgagga       420
     gcttatggtt ctgtcaacaa aatggtccac aaaccaagtg ggcaaataat ggcagttaaa       480
     agaattcggt caacagtgga tgaaaaagaa caaaaacaac ttcttatgga tttggatgta       540
     gtaatgcgga gtagtgattg cccatacatt gttcagtttt atggtgcact cttcagagag       600
     ggtgactgtt ggatctgtat ggaactcatg tctacctcgt ttgataagtt ttacaaatat       660
     gtatatagtg tattagatga tgttattcca gaagaaattt taggcaaaat cactttagca       720
     actgtgaaag cactaaacca cttaaaagaa aacttgaaaa ttattcacag agatatcaaa       780
     ccttccaata ttcttctgga cagaagtgga aatattaagc tctgtgactt cggcatcagt       840
     ggacagcttg tggactctat tgccaagaca agagatgctg gctgtaggcc atacatggca       900
     cctgaaagaa tagacccaag cgcatcacga caaggatatg atgtccgctc tgatgtctgg       960
     agtttgggga tcacattgta tgagttggcc acaggccgat ttccttatcc aaagtggaat      1020
     agtgtatttg atcaactaac acaagtcgtg aaaggagatc ctccgcagct gagtaattct      1080
     gaggaaaggg aattctcccc gagtttcatc aactttgtca acttgtgcct tacgaaggat      1140
     gaatccaaaa ggccaaagta taaagagctt ctgaaacatc cctttatttt gatgtatgaa      1200
     gaacgtgccg ttgaggtcgc atgctatgtt tgtaaaatcc tggatcaaat gccagctact      1260
     cccagctctc ccatgtatgt cgattgatat cgctgctaca tcagactcta gaaaaaaggg      1320
     ctgagaggaa gcaagacgta aagaattttc atcccgtatc acagtgtttt tattgctcgc      1380
     ccagacacca tgtgcaataa gattggtgtt cgtttccatc atgtctgtat actcctgtca      1440
     cctagaacgt gcatccttgt aatacctgat tgatcacaca gtgttagtgc tggtcagaga      1500
     gacctcatcc tgctcttttg tgatgaacat attcatgaaa tgtggaagtc agtacgatcg      1560
     agttgttgac tgtgattaga tcacatctta aattcatttc tagactcaaa acctggagat      1620
     gcagctactg gaatggtgtt ttgtcagact tccaaatcct ggaaggacac agtgatgaat      1680
     gtactatgtc tgaacataga aactcgggct tgagtgagaa gagcttgcac agccaacgag      1740
     acacattgcc ttctggagct gggagacaaa ggaggaattt actttcttca ccaagtgcaa      1800
     tagattactg atgtgatatt ctgttgcttt acagttacag ttgatgtttg gggatcgatg      1860
     tgctcagcca aatttcctgt ttgaaatatc atgttaaatt agaatgaatt tatctttacc      1920
     aaaaaccatg ttgcgttcaa agaggtgaac attaaaatat agagacagga cagaatgtgt      1980
     tcttttctcc tttaccagtc ctatttttca atgggaagac tcaggagtct gccacttgtc      2040
     aaagaaggtg ctgatcctaa gaatttttca ttctcagaat tcggtgtgct gccaacttga      2100
     tgttccacct gccacaaacc accaggactg aaagaagaaa acagtacaga aggcaaagtt      2160
     tacagatgtt tttaattcta gtattttatc tggaacaact tgtagcagct atatatttcc      2220
     ccttggtccc aagcctgata ctttagccat cataactcac taacagggag aagtagctag      2280
     tagcaatgtg ccttgattga ttagataaag atttctagta ggcagcaaaa gaccaaatct      2340
     cagttgtttg cttcttgcca tcactggtcc aggtcttcag tttccgaatc tctttccctt      2400
     cccctgtggt ctattgtcgc tatgtgactt gcgcttaatc caatattttg ccttttttct      2460
     atatcaaaaa acctttacag ttagcaggga tgttccttac caaggatttt tagccccaaa      2520
     tctctcatat tcgctagtgt ttaaaaggct aagaatagtg gggcccagcc gatgtggtag      2580
     gtgataaaga ggcatctttt ctagagacac attggaccag atgaggatcc gaaacggcag      2640
     cctttacgtt catcacctgc tagaacctct cgtagtccat caccatttct tggcattgga      2700
     attctactgg aaaaaaatac aaaaagcaaa acaaaaccct cagcactgtt acaagaggcc      2760
     atttaagtat cctgtgcttc ttcacttacc cattagccag gttctcatta ggttttgctt      2820
     gggcctccct ggcactgaac cttaggcttt gtatgacagt gaagcagcac tgtgagtggt      2880
     tcaagcacac tggaatataa aacagtcatg gcctgagatg caggtgatgc cattacagaa      2940
     ccaaatcgtg gcacgtattg ctgtgtctcc tctcagagtg acagtcataa atactgtcaa      3000
     acaataaagg gagaatggtg ctgtttaaag tcacgtccct gtaaattgca gaattcaaaa      3060
     gtgattatct ctttgatcta cttgcctcat ttccctatct tctcccccac ggtatcctaa      3120
     actttagact tcccactgtt ctgaaaggag acattgctct atgtctgcct tcgaccacag      3180
     caagccatca tcctccattg ctcccgggga ctcaagagga atctgtttct ctgctgtcaa      3240
     cttcccatct ggctcagcat agggtcactt tgccattatg caaatggaga taaaagcaat      3300
     tctgactgtc caggagctaa tctgaccgtt ctattgtgtg gatgaccaca taagaaggca      3360
     attttagtgt attaatcata gattattata aactataaac ttaagggcaa ggagtttatt      3420
     acaatgtatc tttattaaaa caaaagggtg tatagtgttc acaaactgtg aaaatagtgt      3480
     aagaactgta cattgtgagc tctggttatt tttctcttgt accatagaaa aatgtataaa      3540
     aattatcaaa aagctaatgt gcagggatat tgccttattt gtctgtaaaa aatggagctc      3600
     agtaacataa ctgcttcttg gagctttgga atattttatc ctgtattctt gtttgaattc      3660
     ctcctctatt taagatatat acatggaatc gaagtgttta tgtaatagtt ctatcctttt      3720
     gcctgcaggt cagttgtaat aaatctagga tgtgatgatg actttgtaat ttgattttct      3780
     gaaatcagac cctgagaggg gaaaatctta aagtaaatta cattaaatta tctgtgcatt      3840
     tcacaccagg gaaaatg                                                     3857
//

If you have problems or comments...

PBIL Back to PBIL home page