(data stored in ACNUC18858 zone)

EMBL: AK132647

ID   AK132647; SV 1; linear; mRNA; HTC; MUS; 1797 BP.
XX
AC   AK132647;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 0 day neonate head cDNA, RIKEN full-length enriched library,
DE   clone:4833446A21 product:weakly similar to DJ1153D9.2 (Novel protein
DE   similar to beta 1,6-N- acetylglucosaminyltransferase) (Fragment) [Homo
DE   sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1797
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e34c1a86834287c3b1149d63357e29d8.
DR   Ensembl-Gn; ENSMUSG00000074569; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026913; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026922; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026664; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027369; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026122; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026641; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026880; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026764; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025859; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026195; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000099060; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059534; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059567; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059511; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059967; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059166; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059269; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059247; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059379; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059234; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060153; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059050; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058471; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4833446A21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1797
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4833446A21"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..1046
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="weakly similar to DJ1153D9.2 (Novel protein similar
FT                   to beta 1,6-N- acetylglucosaminyltransferase) (Fragment)
FT                   [Homo sapiens] (UniProt|Q9HCV8, evidence: FASTY, 59.2%ID,
FT                   100%length, match=893)"
FT                   /db_xref="GOA:Q3V3K7"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="MGI:MGI:3606143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V3K7"
FT                   /protein_id="BAE21278.1"
FT                   /translation="ELCSALFDGKKAAPQIAQFCKPPQNSEVPARLRTPGNCSRLARGL
FT                   HFITRPLSAEEGNFSLAYVIHAPRELVMFVRLLRAIYAPQNVYCIHSDENAPKKFKSAM
FT                   QTFVDCFGNIFLSSKTQKVAHDNLRRLQAEIDCMRDLVHSPFQWHYVMNLCGQEFPIKT
FT                   NKEIIYDIRTRWKGKNITPGVTPPANSKPKTGQGPPKPSPDENSYTAPNTIFKQSPPHN
FT                   LTISSGSAHYALTRKFVEFVLTDPRAKDMLQWSKDIQSPEKHYWVTLNRLKDHDAQDTC
FT                   VYGLGDLPGLIRLPAFFATLEPSSDPLVGVCLERRHRLRALQQAEVPPEPHWQFPQQSH
FT                   FNSQPHH"
XX
SQ   Sequence 1797 BP; 474 A; 497 C; 427 G; 399 T; 0 other;
     atgaactgtg ctcggcttta tttgacggga aaaaggcagc cccccaaatc gctcaattct        60
     gcaaaccccc tcagaactct gaagttcctg ctcgcttgcg cacacctgga aactgctcca       120
     ggctggctcg ggggctgcac ttcataacca gacccctgtc tgcagaagag gggaacttct       180
     ccttggccta tgttatacat gctccgaggg agctggtcat gtttgtgcgg cttctcagag       240
     cgatttatgc acctcagaat gtctactgta tccacagtga tgaaaatgcc ccaaagaagt       300
     ttaagagtgc catgcaaacc ttcgtggact gttttggaaa catctttctt tcatcaaaga       360
     cacagaaggt ggctcatgac aacctcagga ggctgcaggc agagattgac tgcatgaggg       420
     acctggtcca ctccccattt caatggcact atgtcatgaa tctctgtgga caggaattcc       480
     ctatcaaaac caacaaagaa atcatctatg acatcagaac caggtggaag ggtaaaaaca       540
     tcacgcctgg ggtgacccca cccgcaaact ccaaacccaa gacaggccaa ggccctccaa       600
     agcccagtcc cgatgaaaac agctacacag ctccaaatac aattttcaaa caaagcccac       660
     cccacaatct aacaatttcc tctggaagtg ctcactatgc acttacgagg aagtttgtag       720
     agttcgtcct aactgatccc cgtgcaaaag acatgctgca gtggtccaaa gacatccaaa       780
     gcccggagaa gcactactgg gtgaccctga accgactgaa agaccacgat gcccaagaca       840
     cttgtgtgta tggcctggga gacctgcctg ggctcatccg gctgccagct ttctttgcca       900
     cgctggagcc ctcctcagac ccgctggtgg gagtatgcct agagaggcgg caccgactca       960
     gagccctaca gcaggccgag gtccctccag agccacactg gcagtttccc cagcaaagcc      1020
     acttcaacag tcaacctcac cattaaggca cttgtcagca ttgcttttta aattcttgga      1080
     tgtgaatgat ttaaaaaatg atgcagagac atgtgccacc agacttcacc actacacagg      1140
     cagggagaga actatgagga aaacacccga ggctgtggct aggagcccaa gccaacagct      1200
     ggaggcccag cgcattatca gctgccgaat ctctccacct gctcaatcca gctcacgtgg      1260
     gacacaccag cagcgggtct ggttctgaag gcctagagag cctgagtaag aggcgcatat      1320
     atagcaaagc cccacccaca ggaagccatg cttctctgga gctgtcccta tggactaaga      1380
     gcagtacaac tttgttctag aaaattccag gaaagcattt aggggtagaa tgaataatcc      1440
     cacagaggaa gcaagcttct taagaatgct gcctcaactc tgtgtagtct tggcgtgcca      1500
     tctgctgttc ttcctgccat gttgggggcc acaactgcac tgctcgtgcc acttccacag      1560
     gggcttctgc acacaagagc gtgactttta cggagtgttt cgagttaggt atgtggcaag      1620
     tggccaacac cctggtgtat gggctgaaga cataaaaggc catgaccatc ttgggcctca      1680
     ggtgcaggcc cttccttcct atgtccctga ctgttgctgc tgctgttctg ggaaacttct      1740
     atagatgctc tttctctagc aatgtccttg gtggcataaa gactgacatg ttcaagc         1797
//

If you have problems or comments...

PBIL Back to PBIL home page