(data stored in ACNUC27125 zone)

EMBL: AK133393

ID   AK133393; SV 1; linear; mRNA; HTC; MUS; 1968 BP.
XX
AC   AK133393;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4933408M07 product:protein phosphatase 3, catalytic subunit, gamma
DE   isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1968
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9be4f5e1fe0c49b8a4d85c3a4e8b44f1.
DR   Ensembl-Gn; ENSMUSG00000022092; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021493; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021938; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020793; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021345; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021374; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021962; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020537; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020846; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078434; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040026; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039993; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039947; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040468; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039794; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039761; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039872; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039755; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039348; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039124; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4933408M07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1968
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4933408M07"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        244..1785
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 3, catalytic subunit, gamma
FT                   isoform (MGD|MGI:107162 GB|NM_008915, evidence: BLASTN,
FT                   99%, match=1945)"
FT                   /note="putative"
FT                   /db_xref="GOA:P48455"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48455"
FT                   /protein_id="BAE21630.1"
FT                   /translation="MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNH
FT                   LVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSP
FT                   SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECR
FT                   IKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGP
FT                   VCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQD
FT                   AGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLP
FT                   NFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKM
FT                   ARVFTVLREESENVLTLKGLTPTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAH
FT                   RIRSFEEARGLDRINERMPPRKEASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL"
XX
SQ   Sequence 1968 BP; 522 A; 478 C; 504 G; 464 T; 0 other;
     ggcgcgcagc cgcggtctcc ctagttgtgt ccctcagccg cggtcgccgt agctctcgac        60
     gcggtcgtcc ccgacgagcc gcgggcgccg ccgcagggag ggagcggcgc tgcggccgcc       120
     gccgtccgag gacgccccgt attccggggc ccggcacggt ggctgcccgc tcgccgagcg       180
     cagcccgcct aggaggaagg cggcggcttg cgtccagcgg gccgccggag ccgggaggag       240
     accatgtccg tgaggcgccc tcagttctcc acgaccgagc gcgtcatcaa agctgtcccc       300
     tttcctccaa cccgacggct aactttgaag gaagtttttg agaatgggaa acctaaaatg       360
     gatcttttga aaaaccattt agtaaaagaa ggtcgggtgg aagaggaggt ggccttaaag       420
     atcatcaatg atggggctgc catcctgaag caggagaaga ccatgataga ggtggaggct       480
     ccgatcacag tgtgtggtga tgttcatgga caattctttg acctgatgaa gttgtttgaa       540
     gttgggggat cacctagtaa tactcgctac ctcttcctgg gtgactatgt ggacagaggc       600
     tatttcagta tagagtgtgt gctgtatcta tggagcttaa agattaacca tcctaaaaca       660
     ttgtttctgc ttcgaggaaa tcatgaatgc aggcatctta cagagtactt caccttcaaa       720
     caggaatgtc ggatcaagta ttcagagatg gtgtacgatg cgtgcatgca cactttcgac       780
     tgtcttcctc ttgctgccct cttaaaccag cagtttctct gtgtacatgg aggaatgtct       840
     cctgaaatta cttgtttaga ggacattagg aaattagata ggttttctga gcctcctgct       900
     tttgggccag tgtgtgacct gctgtggtct gatcccttag aggactacgg cagcgagaag       960
     accctggagc actataccca caacactgtc cgaggctgct cctacttctt cagttaccct      1020
     gcagtttgtg aatttttaca gaacaacagt ttattatcaa taatcagagc ccatgaagcc      1080
     caggatgcgg ggtaccgaat gtataggaag aaccaagcaa ctggctttcc gtcacttatt      1140
     acgattttct ctgcccctaa ttacctagat gtctataaca ataaagctgc agtgttgaag      1200
     tatgaaaaca atgtcatgaa catcaggcag ttcaactgtt ccccacaccc ctactggctc      1260
     ccaaacttca tggatgtttt cacgtggtct ttgccttttg ttggagagaa agtgacagag      1320
     atgctggtca atattctcaa catatgctcg gatgaagaaa tgaacgtaac cgatgaagaa      1380
     ggagctacta caggtcgaaa agaagtcatc aagaataaaa tccgagccat tgggaaaatg      1440
     gcccgggtct ttacggttct tcgggaagag agtgagaatg tgctgaccct caagggcctc      1500
     actcccacag gcacactccc actgggggtc ctctctggag gaaagcagac cattgagact      1560
     gccaaacaag aagccgcaga ggagcgggaa gccatcagag gttttacaat tgcacacagg      1620
     atccgaagtt ttgaagaagc ccgaggtcta gaccgaatta atgagagaat gccaccccga      1680
     aaagaggctt catatcatca tgatgcaggg aggatgcact cacactcgca tccgccacac      1740
     ccacaggcgt caagaaggac cgaccatgga aagaaagccc tgtaatgact cagggccctg      1800
     tgcagcacag atgggtccca accctatgag caaatcacat ttatttatac tggaaatgaa      1860
     acaggaacaa ctcaaacaac ttaaacttgg aggtgcattt gtaattcagt cgcatttatt      1920
     ctgtaagaaa aatgaccatt ttataaattc ttctaattta tgttcaat                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page