(data stored in ACNUC10243 zone)

EMBL: AK133860

ID   AK133860; SV 1; linear; mRNA; HTC; MUS; 1893 BP.
XX
AC   AK133860;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 8 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:5730458M06 product:Heterogeneous nuclear ribonucleoprotein
DE   A3 (hnRNP A3), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1893
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 87a9725bca8a3c92888f60f46644932f.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5730458M06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1893
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5730458M06"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        59..1198
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Heterogeneous nuclear ribonucleoprotein A3 (hnRNP
FT                   A3) (UniProt|Q8BG05, evidence: FASTY, 99.7%ID, 100%length,
FT                   match=1137)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UZG3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZG3"
FT                   /protein_id="BAE21894.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGRRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
FT   regulatory      1866..1871
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1893
FT                   /note="putative"
XX
SQ   Sequence 1893 BP; 552 A; 274 C; 541 G; 526 T; 0 other;
     gctcttcctc tcggtcccat attgaactcg agttggaaga ggcgagtccg gtctcaaaat        60
     ggaggtaaaa ccgccgcccg gtcgccccca gcctgactcc ggccgtcgcc gccgccgccg       120
     gggggaggag ggccatgatc caaaggaacc agagcagctg aggaagctat ttattggtgg       180
     tctgagcttt gaaaccacag atgatagctt aagagaacat tttgagaaat ggggcacact       240
     tacagactgt gtggtaatga gagatcccca aacaaaacgt tccagaggct ttggttttgt       300
     gacctactct tgtgttgaag aggtggatgc tgcaatgtgt gctcggccac acaaggttga       360
     tgggcgtgtg gtggaaccga agagagctgt ttctagagag gattctgtaa agcctggtgc       420
     ccatttaacg gtgaagaaaa tttttgttgg tggtattaaa gaggatacgg aagaatataa       480
     cctgagagac tactttgaaa agtatggcaa gattgaaacc atagaggtta tggaagacag       540
     gcagagtggg aaaaagagag gatttgcttt tgtaactttt gatgatcatg acacagttga       600
     taaaattgtt gttcagaaat accacactat taatgggcat aattgtgaag tgaaaaaggc       660
     cctttctaaa caagagatgc agtctgctgg atcacagaga ggtcgtggag gtggatctgg       720
     caactttatg ggtcgtggag gaaactttgg aggtggtgga ggaaactttg gtcgtggagg       780
     aaactttggt agaagaggtg gctatggtgg tggaggtggt ggcagcagag gtagttatgg       840
     aggtggtgat ggtggatata atggatttgg aggtgatggt ggcaactatg gtggtggtcc       900
     tggttacagc agtagaggag gttatggagg tggtggacca ggatatggaa accagggtgg       960
     tggatatggt ggtggaggag gaggctatga tggttacaat gaaggaggaa attttggtgg      1020
     aggtaactat ggtggtggtg gaaactataa tgactttgga aattatagtg gacagcaaca      1080
     atcaaattat ggacccatga aggggggcag ttttggtgga agaagctcag gcagtcccta      1140
     tggtggtggc tatggatctg gaggtggaag tggtggatat ggtagcagaa ggttttaaaa      1200
     taaaacagaa acggctacag ttcttagcag gagagagagc gaggagttgt caggaaagct      1260
     gcaggttact ttgagacagt cgtcccaaat gcattagagg aactgtaaaa atctgccaca      1320
     gaaggaacga tgatccatag tcagaaaagt tactgcagct taaacaggaa acccttcttg      1380
     ttcaggactg acatagccac agtttgcaaa aagtgcagct attgattaat gcaatgtagt      1440
     gtcaattaga tgtacattcc tgaggtcttt tatctgttgt agctttgtct ttttcttttt      1500
     cttttcatta catcaggtat attgccctgt aaattgtggt agtggtacca ggaataaaaa      1560
     attaaggaat ttttaacttt tcaatatttg tgtagttcag tttttctaca ttttagtaca      1620
     gaaactttaa caaaatgcag tttcgaaggt gtttccttgt gagttaacac gtgaagaaga      1680
     tcattgttaa ttactatttt gtatgaattt tgctaaagtt aactgtaaag aaacacctac      1740
     tgacttgcaa tttaagggga atctattctc cccatttcca aaacaatgat gaatgggcgc      1800
     tgacatgtgg agagaataga tatttgtatg tttgcaatgt gtgttttaga taattagaat      1860
     tgggaaataa aaaaatagca tatttgtgaa ttt                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page