(data stored in ACNUC5448 zone)

EMBL: AK139581

ID   AK139581; SV 1; linear; mRNA; HTC; MUS; 4029 BP.
XX
AC   AK139581;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 cells egg cDNA, RIKEN full-length enriched library,
DE   clone:B020005I05 product:Trad homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4029
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c5873d35514270a9a07901a27f4ce0c3.
DR   Ensembl-Gn; ENSMUSG00000061751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000232157; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B020005I05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4029
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 cells"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B020005I05"
FT                   /tissue_type="egg"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1213..3297
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Trad homolog [Homo sapiens] (UniProt|Q9Y2A5,
FT                   evidence: FASTY, 94.6%ID, 54.4%length, match=2104)"
FT                   /note="putative"
FT                   /db_xref="GOA:A2CG49"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR028569"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="MGI:MGI:2685385"
FT                   /db_xref="PDB:1WFW"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2CG49"
FT                   /protein_id="BAE24075.1"
FT                   /translation="MKGGDQAYTRGPSLGWLFAKCCCCFPCRDSYSHSSSENGGKSESV
FT                   AHLQSQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFD
FT                   LGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLA
FT                   ARQAPPDVPTAADLVSAIEKLVKNKLTLEGGSYRGSLKDPTGCLNEGMTPPTPPRNLEE
FT                   EQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKEKIVFGNI
FT                   HQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAY
FT                   FEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLV
FT                   PKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIF
FT                   SELLRKGSLTPGYMFKRSIKMNYLVLEDNVDGDPCKFALMNRETSERVILQAANSDIQQ
FT                   AWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVIRSQPPRVPQASPRPYSSGPVGSE
FT                   KPPKGSSYNPPLPPLKISTSNGSPGFDYHQPGDKFDASKNDLGGCNGTSTMTVIKDYYA
FT                   LKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLAQSQSRGRK
FT                   "
XX
SQ   Sequence 4029 BP; 1054 A; 989 C; 1013 G; 973 T; 0 other;
     gaaccctcga ctcctgagcc atatctctag tccacagctc cttttcccct gaggaatgga        60
     cctgctttac gaatgcttca tccttcccac aagccctttc ccctaaagct gggcaagaac       120
     tagtgggagc aataggctat gagcgatgtg atcagtgact catggtccgg ctgatgctgt       180
     tgaacttcaa ggatgctggt aaacactaag cttggccttg aaccatgaga aagacataag       240
     aagaaaagta cagggatgaa gaaaaaaaga gtgataaatt catggattat agtagggagg       300
     agatagtggg agccctcctc agtaggtagg tggtgcttga attttgtctg caggcattca       360
     ctcaccagga ccattaaaca tcacctctgt gagtgtcttt ttataaattc ccagcagggt       420
     cttgctatac agccctggca catcttagct cctgaacctc cagcctcagc ctccctggtc       480
     acgtactacc acacccatct gttttcgttt tattttaaag agaacactga agttggcaaa       540
     aagcaaatta tctagcctaa ggtcagacag ttagccagtg gcaaaagtga gatttgaact       600
     gtagttctta ttatgccaaa cccagaaagt ttttgcacat cattttagta ggggagccga       660
     taaggaagtg agggatctct gtcattatta gttgtaagca ttaaaagaaa ggaaaaagat       720
     gaggggtttt tttaatgaga ggagatgagg ggaatctgat agggactaag tattgttttt       780
     gagtcttcta cccctctttg gcctcatcta gcactgtgtt agaagctaaa gctgattagg       840
     gtggccttta gaagtctcac ctaagtatct gttttgcggc gggggactgc gctctcagta       900
     cctcctggat acccacaacc acacaggcgt gtttgcctgt ttcataaggc tcagggacgc       960
     tgccgactgt gtccccaacc aacagctgga ccttggaact ccgccccctt agtccctccc      1020
     ttgccgcctg gcccctccct cctgcctaag gtggcccaac tccctgtaag ttccagcacc      1080
     gccggggtgc gggaggagga cggcaggcgg gaacaggacc tggctggcgg gtggcactga      1140
     agtttcctac cgccgcgctc tcaccccggc cggcgttcgt gccatgccgg agcactggga      1200
     gcgcgctgca gcatgaaggg tggcgatcag gcttacaccc gaggtccctc tttgggctgg      1260
     ctctttgcta agtgctgctg ttgcttccct tgtagagatt catactctca ttcctccagt      1320
     gagaatggag gcaaatccga gtccgtggcc cacctgcagt ctcagccctc cctgaactcc      1380
     atccacagtt cccctggtcc caagcgctcc accaacaccc tcaaaaagtg gctgaccagc      1440
     cccgtgcgcc gcctcaacag cggaaaagcc gacgggaaca tcaaaaagca gaagaaagtc      1500
     cgggatgggc ggaagagctt cgatctggga tcgcccaagc ctggggatga gacgacacct      1560
     cagggagaca gcgctgacga gaagagcaag aagggttggg gcgaagacga gccagatgaa      1620
     gagtcacaca cacccctccc tccgcccatg aagatctttg acaacgaccc cacacaggat      1680
     gagatgtcgt ctttgctagc agcccggcag gctccccctg acgtgcctac tgctgcagac      1740
     cttgtcagtg caatagaaaa gttggtcaaa aataagctga ctctggaagg aggctcttac      1800
     cgggggagct tgaaggaccc tacaggctgc ctgaatgagg ggatgacccc tcccacacct      1860
     cctagaaacc tggaagaaga acagaaagcc aaggcgctga gaggcaggat gtttgtcctg      1920
     aatgagctgg tacagacaga gaaggactac gtcaaggacc tggggattgt ggtggagggc      1980
     ttcatgaaga gaatagaaga gaagggggtc cctgaggaca tgcgagggaa ggaaaagatc      2040
     gtgtttggaa atatccacca gatttacgac tggcataaag attttttcct ggctgaactg      2100
     gaaaaatgta tccaagagca agacagattg gcccagctct tcattaaaca cgagcggaag      2160
     ctgcacatct acgtgtggta ctgccagaac aagccgcgtt ccgagtacat cgtggctgag      2220
     tacgatgcct attttgagga ggttaaacaa gagatcaatc aaaggctgac ccttagtgac      2280
     ttcctgatca agcccattca gagaataaca aagtaccagc tgctactcaa ggacttcctg      2340
     cgatacagcg agaaggctgg tttggagtgt tccgatattg agaaagcagt ggagttaatg      2400
     tgccttgtcc ccaagcgctg taatgacatg atgaatctgg gacgcctgca gggcttcgag      2460
     ggcaccctga ccgcccaggg caagctactg cagcaggaca cattctatgt gatcgagctg      2520
     gatgccggca tgcagtcccg gaccaaggag aggcgtgtgt ttctctttga gcagattgtc      2580
     atcttcagtg aactgctccg aaaggggtcc ctcaccccag gctacatgtt caaaagaagc      2640
     atcaagatga attacttggt cctggaagac aatgtggatg gtgacccctg caaatttgca      2700
     ctcatgaaca gggagacttc agaaagggtc attctacagg ctgccaactc agacatccag      2760
     caggcctggg tgcaggacat caaccaagtc ctagaaacac agagggactt cttaaatgca      2820
     ctacagtcac ccattgagta tcagcggaag gagagaagca cagctgtgat ccggtcccag      2880
     cccccgaggg ttccacaagc cagccccagg ccctactctt ctggcccggt gggctcagag      2940
     aagcccccca agggctccag ctataacccg cctctgccac ccctgaagat atctacctct      3000
     aatggcagtc cagggttcga ctaccatcag cctggggaca agtttgacgc tagcaagaac      3060
     gacctgggag gctgcaatgg gacatcaacc atgactgtaa tcaaagatta ctatgcactg      3120
     aaggagaatg aaatctgcgt gagccaaggt gaggtggtac aggtcctcgc cgtcaaccag      3180
     cagaacatgt gtctggtgta ccagcctgcc agcgaccatt ccccggcagc agagggctgg      3240
     gtcccaggca gcatcctggc gcccctcgcc caaagccaaa gcagggggcg aaagtaggga      3300
     gggaagacta aaaaaagaac cctactgaaa ccctagggga gaaaaaaggc atgcctccgg      3360
     tgctaaattg ggcccaacag gggaactaac ggaactggaa ctctaatcat attgtatgaa      3420
     gttactgata tatatatatt ttttttttga ttggcaccta gaaatgacct tagcacaaat      3480
     gccaggcctg gacaggtcag agcctgctgc ttctcccaaa agagagggga cttttttttt      3540
     tttttttttt ttggctgtcc acggcaattc cactgtacag attgtaactt tttattttta      3600
     tttctctcct cccctgtcac tttaatatat gttcatggta atttgtaaga tattcctttt      3660
     ccttattttg attgcaaaaa ctcttctgaa cacattcctg tataaagcat tttgcactat      3720
     ttaaagaaac ccttgtggat gaagtcaggt tgtgcaatat cgggagccgc aatgtttagc      3780
     attgtacctg taatgtaact aataatttta aatgtactat tttaaatatg taaaataaat      3840
     tttcaccatg agcatgtttt aatgaggtca aaggttagtt gacccttccc tcccccatct      3900
     cattattctc agactttgag tgtgaaaatg attttttttt cctttctttt ctatagttta      3960
     tgggttggtt ggctgcattg tttgtttttt ttttgttttc ttcctatata aaaggtgcct      4020
     ttgttgccc                                                              4029
//

If you have problems or comments...

PBIL Back to PBIL home page